tag:blogger.com,1999:blog-34766228053641907552023-12-09T11:33:36.834-07:00Animated Film ReviewsThe bold new films taking over Hollywood.Unknownnoreply@blogger.comBlogger768125tag:blogger.com,1999:blog-3476622805364190755.post-58218775296192538362020-04-12T15:49:00.004-06:002021-01-18T01:24:02.135-07:00Heavy Metal (1981) - Comic Book Psychedelic Fantasy<div itemscope="" itemtype="https://schema.org/Movie">
<h1>
Sexy "Heavy Metal" Has Something for All Mature Audiences</h1>
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-2NVHOb79Jk0/XpN-Fxy153I/AAAAAAACgzo/-3eidHZb7cAAbnDGD-WEKXV9qgXzo7t0ACLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_12.gif" style="margin-left: auto; margin-right: auto;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" src="https://1.bp.blogspot.com/-2NVHOb79Jk0/XpN-Fxy153I/AAAAAAACgzo/-3eidHZb7cAAbnDGD-WEKXV9qgXzo7t0ACLcBGAsYHQ/s16000/Heavy_Metal_animatedfilmreviews.filminspector.com_12.gif" title="Heavy Metal (1981)" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Elon Musk reportedly used this sequence from the "Soft Landing" segment of "Heavy Metal" as inspiration for his "starman" project.</td></tr>
</tbody></table>
"<b>Heavy Metal</b>" (<span>1981</span>) is largely forgotten by most people, but it has a devout cult following among lovers of both <span>animated sci-fi fantasy</span> films and 1970s rock music. It is a film of its time, but if you were there, you recognize the style and the ethos. "Heavy Metal" is enjoyable by modern audiences as long as they can appreciate a wild tale of savage beauty.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-SgB4U9KYp3M/XpVAfPyGxsI/AAAAAAACg2Y/E1DXM0swSP01TohnZZKPZWgM3T7UV3UUACLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_18.webp" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="356" height="360" src="https://1.bp.blogspot.com/-SgB4U9KYp3M/XpVAfPyGxsI/AAAAAAACg2Y/E1DXM0swSP01TohnZZKPZWgM3T7UV3UUACLcBGAsYHQ/w640-h360/Heavy_Metal_animatedfilmreviews.filminspector.com_18.webp" title="Heavy Metal (1981)" width="640" /></a></div>
Yes, it contains drug and sexual references and a whole lot of violence. However, "Heavy Metal" also offers some wry commentary on cultural conditions amidst a lot of unrestrained and thoughtful imagination. There is a lot of serious insight right beneath the surface of "Heavy Metal" if you care to look and see it.<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-vKvF5nejJXs/XpN8pfLE7oI/AAAAAAACgzc/0QJpfRdhCY4JEXixkKWIebNXnFoTjHFVwCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_11.gif" style="margin-left: auto; margin-right: auto; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" height="360" src="https://1.bp.blogspot.com/-vKvF5nejJXs/XpN8pfLE7oI/AAAAAAACgzc/0QJpfRdhCY4JEXixkKWIebNXnFoTjHFVwCLcBGAsYHQ/w640-h360/Heavy_Metal_animatedfilmreviews.filminspector.com_11.gif" title="Heavy Metal (1981)" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">I consider this scene of Taarna flying one of the highlights of "Heavy Metal" and strikingly good animation.</td></tr>
</tbody></table>
An anthology mélange like the eponymous magazine on which it is based, "Heavy Metal" is a collection of disparate tales that are tied together with the loosest of thread - much like the outfit of one of the main characters, Taarna.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-XIxlOdMzdPA/XpoRlXwdGhI/AAAAAAACg5c/KtkCFuv-o9oMcmJ0C00IWxiArztEjeKwQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_19.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" height="360" src="https://1.bp.blogspot.com/-XIxlOdMzdPA/XpoRlXwdGhI/AAAAAAACg5c/KtkCFuv-o9oMcmJ0C00IWxiArztEjeKwQCLcBGAsYHQ/w640-h360/Heavy_Metal_animatedfilmreviews.filminspector.com_19.gif" title="Heavy Metal (1981)" width="640" /></a></div>
Despite getting little respect from professional film critics, "Heavy Metal" has served as inspiration for many later works including "The Fifth Element" (scruffy futuristic taxi driver saves redhead), "Blade Runner" (flying cars), an episode of <a href="https://animatedfilmreviews.filminspector.com/p/top-ten-south-park-episodes.html" target="_blank">the animated television series "South Park"</a> and "Heavy Metal's own 2000 sequel. That's not a bad legacy at all for a low-key animated feature film not made by one of the major studios.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-AqwzHPrjBqo/XpU4zebTXFI/AAAAAAACg10/-uJbLbHfbwY9Tutq6PbtT1GeTtBnFe3owCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_15.webp" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="370" height="345" src="https://1.bp.blogspot.com/-AqwzHPrjBqo/XpU4zebTXFI/AAAAAAACg10/-uJbLbHfbwY9Tutq6PbtT1GeTtBnFe3owCLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_15.webp" title="Heavy Metal (1981)" width="640" /></a></div>
Produced by <span itemscope="" itemtype="https://schema.org/Person"><span>Ivan Reitman</span></span> and Leonard Mogel, who also was the publisher of Heavy Metal magazine, "Heavy Metal" was rated "R." How it escaped an "X" rating is a bit of a mystery, but those were different times with different standards. Be advised that "Heavy Metal" is for mature audiences only due to its violence, adult themes, and sexual imagery.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-vVKGy0Hld90/XpN4farNF2I/AAAAAAACgy4/4msMXo3zRNIDL8muc5_WJEB_G0fher0aACLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_6.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="371" height="345" src="https://1.bp.blogspot.com/-vVKGy0Hld90/XpN4farNF2I/AAAAAAACgy4/4msMXo3zRNIDL8muc5_WJEB_G0fher0aACLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_6.gif" title="Heavy Metal (1981)" width="640" /></a></div>
Many veterans of "Second City," a comedy troupe based in Chicago and who were friends of Reitman, voiced the characters. These included John Candy (voicing several characters), Rodger Bumpass, Jackie Burroughs, Joe Flaherty, Don Francks, Martin Lavut, Marilyn Lightstone, Eugene Levy, Alice Playten, Harold Ramis, Percy Rodriguez, Susan Roman, Richard Romanus, August Schellenberg, John Vernon (the principal from "Animal House"), and Zal Yanovsky.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-HtbBE3UVCaE/XpU7Ok3YI1I/AAAAAAACg2A/D33D8qlTxysVL7TutgaX3nckZCZXP0rzwCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_16.webp" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="369" height="346" src="https://1.bp.blogspot.com/-HtbBE3UVCaE/XpU7Ok3YI1I/AAAAAAACg2A/D33D8qlTxysVL7TutgaX3nckZCZXP0rzwCLcBGAsYHQ/w640-h346/Heavy_Metal_animatedfilmreviews.filminspector.com_16.webp" title="Heavy Metal (1981)" width="640" /></a></div>
Begun in 1977, Heavy Metal magazine was owned by the <span>National Lampoon company</span>, which did "Animal House" and many other very irreverent motion pictures. That explains the irreverent tone of Heavy Metal.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-LZ4dfQXdsts/XpN4DGyVseI/AAAAAAACgyY/a0UsEEE_XfI9g7cYgbKxjd2Wg4r5m-OyQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_1.gif" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="500" height="345" src="https://1.bp.blogspot.com/-LZ4dfQXdsts/XpN4DGyVseI/AAAAAAACgyY/a0UsEEE_XfI9g7cYgbKxjd2Wg4r5m-OyQCLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_1.gif" title="Heavy Metal (1981)" width="640" /></a></div>
"Heavy Metal" has many different animation styles. They are not all top-flight, but they are original and highly personal. To use one word to describe them all, I would use "gritty." Some of the styles harken back to the 1960s "Yellow Submarine" era, while others are extremely sophisticated and approach CGI quality (which was not available in 1981). Like the magazine, "Heavy Metal" has images that look more like pop art than typical comic book poses.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-fUk4pUnIjJo/XppEMLVnb3I/AAAAAAACg5o/lChBl_6xOVwrYS9kk9_9sS63f91pZ3fMQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_20.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="272" data-original-width="500" height="347" src="https://1.bp.blogspot.com/-fUk4pUnIjJo/XppEMLVnb3I/AAAAAAACg5o/lChBl_6xOVwrYS9kk9_9sS63f91pZ3fMQCLcBGAsYHQ/w640-h347/Heavy_Metal_animatedfilmreviews.filminspector.com_20.gif" title="Heavy Metal (1981)" width="640" /></a></div>
The rotoscoping technique, wherein actors play out scenes and then are traced as animation, is used throughout. This gives "Heavy Metal" a very realistic appearance.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-ZE7ieDOLyh8/XpU0DXrSIcI/AAAAAAACg1c/LLSfaREa3Jo-XIdmmIo-Rgf8CFDNuGJCQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_13.webp" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="370" height="345" src="https://1.bp.blogspot.com/-ZE7ieDOLyh8/XpU0DXrSIcI/AAAAAAACg1c/LLSfaREa3Jo-XIdmmIo-Rgf8CFDNuGJCQCLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_13.webp" title="Heavy Metal (1981)" width="640" /></a></div>
The "Heavy Metal" storyline is tied together by a mysterious orb known as the Loc-Nar that travels throughout the universe, including Earth. The Loc-Nar takes on different forms throughout "Heavy Metal" and exhibits magical and very dangerous properties. Let's be real - the Loc-Nar is the weakest part of "Heavy Metal" because it is just this undefined "thing" whose only substance is that it serves to frame the other stories. The film drifts far and wide during its different stories, but ultimately they are tied together by a tenuous but ultimately satisfying framing device.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-ZM6qD8QSqLs/XpN4CEayrxI/AAAAAAACgyU/AAm6lRmUndEcLmYXYmCuCNNSC48ZH17kwCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_10.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="360" height="480" src="https://1.bp.blogspot.com/-ZM6qD8QSqLs/XpN4CEayrxI/AAAAAAACgyU/AAm6lRmUndEcLmYXYmCuCNNSC48ZH17kwCLcBGAsYHQ/w640-h480/Heavy_Metal_animatedfilmreviews.filminspector.com_10.gif" title="Heavy Metal (1981)" width="640" /></a></div>
The stories in order are:<br />
<ul>
<li><b>Soft Landing</b></li>
<li><b>Grimaldi</b></li>
<li><b>Harry Canyon</b></li>
<li><b>Den</b></li>
<li><b>Captain Sternn</b></li>
<li><b>Neverwhere Land</b></li>
<li><b>B-17</b></li>
<li><b>So Beautiful and Dangerous</b></li>
<li><b>Taarna</b></li>
<li><b>Epilogue</b></li>
</ul>
Rather than go through the different plots, I'm just going to point out the parts of the film that really stand out.<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-Jh5J72ao_88/Xp_JMSX4aZI/AAAAAAAChD0/3wpANA_68FYYHAXxr_J4SCDskyoJGbkUwCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_21.gif" style="margin-left: auto; margin-right: auto;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" height="360" src="https://1.bp.blogspot.com/-Jh5J72ao_88/Xp_JMSX4aZI/AAAAAAAChD0/3wpANA_68FYYHAXxr_J4SCDskyoJGbkUwCLcBGAsYHQ/w640-h360/Heavy_Metal_animatedfilmreviews.filminspector.com_21.gif" title="Heavy Metal (1981)" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">The B-17 story is tight and surprisingly realistic despite the supernatural theme.</td></tr>
</tbody></table>
The animators basically went where they wanted to go - the B-17 story was made by a World War II veteran who just wanted to tell a supernatural tale from that conflict - and things branch off in different directions. "Heavy Metal" thus features creativity run wild, which either comports with what you want from an animated feature film or doesn't. Any fan of animation should get a thrill out of it.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-CVe7kA8S31Y/XpN4JU_0JNI/AAAAAAACgyk/6miQrLRmphUeNEmtaC13TXrOcY53wu2pQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_4.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="266" data-original-width="500" height="338" src="https://1.bp.blogspot.com/-CVe7kA8S31Y/XpN4JU_0JNI/AAAAAAACgyk/6miQrLRmphUeNEmtaC13TXrOcY53wu2pQCLcBGAsYHQ/w640-h338/Heavy_Metal_animatedfilmreviews.filminspector.com_4.gif" title="Heavy Metal (1981)" width="640" /></a></div>
After the brilliantly drawn introduction, "Soft Landing," the first memorable sequence is "Harry Canyon." This tale follows a savvy cab driver in a dystopian New York City. The city of "Harry Canyon" is an obvious extension of trends that had been playing out in the decaying NYC of the 1970s. It is full of seediness and squalor with nobody really giving a damn about anything but their own self-preservation and enrichment. However, the city tableaus are instantly recognizable despite the futuristic elements of being set in 2031 if you are at all familiar with the New York of the late 1970s.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-URoqZatOVQ8/XpN4Gat0kwI/AAAAAAACgyc/q5NjH68Yi6MPDi-wb1hBDMZHdfjQcCFOACLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_2.gif" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="278" data-original-width="498" height="355" src="https://1.bp.blogspot.com/-URoqZatOVQ8/XpN4Gat0kwI/AAAAAAACgyc/q5NjH68Yi6MPDi-wb1hBDMZHdfjQcCFOACLcBGAsYHQ/w640-h355/Heavy_Metal_animatedfilmreviews.filminspector.com_2.gif" title="Heavy Metal (1981)" width="640" /></a></div>
Easily the most memorable and exciting story, however, is "Taarna" near the end. She is a Taarakian warrior, the last one, in fact. Taarna is summoned by city leaders who are under attack by the Loc-Nar (it is never explained why the Loc-Nar does what it does, it just... does it). This story obviously was strongly influenced, if not directly inspired, by the comic book story "Arzach" by Moebius (real name Jean Giraud, who founded the French magazine "<i>Métal hurlant</i>" that led directly to "Heavy Metal" magazine). "Taarna" is replete with scenes of righteous fury, sheer savagery, and absolutely stunning animation. This ain't Disney, folks. The wicked tale of revenge and retribution in "Taarna" serves as a fitting and fulfilling climax to "Heavy Metal."<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-WFrZDHiDKvU/XpN4bSvZRcI/AAAAAAACgy0/nzj17BKZ4xkzwmdGyML_TcddH57Jx0--wCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_3.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="269" data-original-width="498" height="345" src="https://1.bp.blogspot.com/-WFrZDHiDKvU/XpN4bSvZRcI/AAAAAAACgy0/nzj17BKZ4xkzwmdGyML_TcddH57Jx0--wCLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_3.gif" title="Heavy Metal (1981)" width="640" /></a></div>
Strong, beautiful, and mute (like the character in "Arzach"), Taarna acts like a gunfighter from the Spaghetti Western genre, although she uses a sword instead of a gun. The "Taarna" segment exemplifies fantasy fulfillment for both men and women. Taarna's physical attributes are amply on display for the guys while her cool, savage, effective dispatch of the bad guys portrays a unique female superhero that has not been equaled.<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-itINsmy79gQ/XpU-G3qtg4I/AAAAAAACg2M/CgMQo-6BIo4doxMyx4PYs8vJnSl6FV2_QCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_17.webp" style="margin-left: 1em; margin-right: 1em;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="369" height="345" src="https://1.bp.blogspot.com/-itINsmy79gQ/XpU-G3qtg4I/AAAAAAACg2M/CgMQo-6BIo4doxMyx4PYs8vJnSl6FV2_QCLcBGAsYHQ/w640-h345/Heavy_Metal_animatedfilmreviews.filminspector.com_17.webp" title="Heavy Metal (1981)" width="640" /></a></div>
By now, I hope you have a good idea of what "Heavy Metal" is about. While full of obvious 1970s drug references, it is not a film only for potheads or lovers of "Dungeons and Dragons." "Heavy Metal" some real art and some amazingly good rock songs from the likes of <span itemscope="" itemtype="https://schema.org/Person"><span>Don Felder</span></span> of the Eagles (his "Heavy Metal (Takin' a Ride)" is a showstopper tune), <span style="white-space: pre;"> </span>Blue Öyster Cult (yes, they did songs other than "Fear the Reaper"), Sammy Hagar, Devo, Cheap Trick, and Stevie Nicks). Elmer Bernstein of all people did the score, which shows clear echoes of his score the same year for "An American Werewolf in Paris."<br />
<a href="https://1.bp.blogspot.com/-N4Sv51nojBs/XpU2WmkYyHI/AAAAAAACg1o/MDayNrud5K0Al1TeXBie14-7DmVgkpA3QCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_14.webp" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" height="360" src="https://1.bp.blogspot.com/-N4Sv51nojBs/XpU2WmkYyHI/AAAAAAACg1o/MDayNrud5K0Al1TeXBie14-7DmVgkpA3QCLcBGAsYHQ/w640-h360/Heavy_Metal_animatedfilmreviews.filminspector.com_14.webp" title="Heavy Metal (1981)" width="640" /></a><br />This is an animation by adults for adults. It is uplifting in a very strange and savage sort of way and is a virtual peek into a certain mindset of the late 1970s. If you are interested in animation other than Disney princesses and are adventurous, I say, give it a whirl.<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/SYqEgFEkxek" width="640"></iframe></center>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-USPJi3Vk44c/XpN4IBJaEiI/AAAAAAACgyg/_N8HzBh05aEr8qQX85PuBOJ7atyjkKYdACLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_5.jpg" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="726" data-original-width="1290" height="358" src="https://1.bp.blogspot.com/-USPJi3Vk44c/XpN4IBJaEiI/AAAAAAACgyg/_N8HzBh05aEr8qQX85PuBOJ7atyjkKYdACLcBGAsYHQ/w640-h358/Heavy_Metal_animatedfilmreviews.filminspector.com_5.jpg" title="Heavy Metal (1981)" width="640" /></a></div>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-uOjmDg6zP7Q/XpN40Y_OrSI/AAAAAAACgzI/IVvGevLEV8Y7nYqKwiD8h4GabZWVkGQVQCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_8.gif" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="300" data-original-width="400" height="300" src="https://1.bp.blogspot.com/-uOjmDg6zP7Q/XpN40Y_OrSI/AAAAAAACgzI/IVvGevLEV8Y7nYqKwiD8h4GabZWVkGQVQCLcBGAsYHQ/w400-h300/Heavy_Metal_animatedfilmreviews.filminspector.com_8.gif" title="Heavy Metal (1981)" width="400" /></a></div>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-btGv87TUwYI/XpN4kdzLXtI/AAAAAAACgy8/espiPx4pZVQ4BwnGOoJGpf_EE8jS05D9QCLcBGAsYHQ/s1600/Heavy_Metal_animatedfilmreviews.filminspector.com_9.gif" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Heavy Metal (1981) animatedfilmreviews.filminspector.com" border="0" data-original-height="162" data-original-width="240" height="426" src="https://1.bp.blogspot.com/-btGv87TUwYI/XpN4kdzLXtI/AAAAAAACgy8/espiPx4pZVQ4BwnGOoJGpf_EE8jS05D9QCLcBGAsYHQ/w640-h426/Heavy_Metal_animatedfilmreviews.filminspector.com_9.gif" title="Heavy Metal (1981)" width="640" /></a></div>
<br />
<span class="updated">2021</span></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-32380378854942288522020-03-02T16:40:00.001-07:002020-03-02T16:40:12.522-07:00Israeli Politicians Animation<div itemscope="" itemtype="https://schema.org/Thing">
<h1>
Battle of the Titans?</h1>
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-BUTFPmYVkvg/Xl2XSmJ1GrI/AAAAAAACgH8/DceG9VKyMgsYv9HKK6bCwoZkRSxYIFPgwCLcBGAsYHQ/s1600/State_of_Israel_anime_animatedfilmreviews.filminspector.com_1.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Israeli election anime animatedfilmreviews.filminspector.com" border="0" data-original-height="321" data-original-width="640" height="321" itemprop="image" src="https://1.bp.blogspot.com/-BUTFPmYVkvg/Xl2XSmJ1GrI/AAAAAAACgH8/DceG9VKyMgsYv9HKK6bCwoZkRSxYIFPgwCLcBGAsYHQ/s640/State_of_Israel_anime_animatedfilmreviews.filminspector.com_1.jpg" title="" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">"State of Israel."</td></tr>
</tbody></table>
Israeli politics reached a critical point in early 2020 with the battle between Benjamin Netanyahu, Benny Gantz, and Avigdor Liberman. So, some animators decided to look at the situation anime-style. The result was their series of videos of which two are reproduced below, “<b itemprop="name">State of Israel Anime</b>.”<br />
<br />
The video was the brainchild of Theo Dolev and Akim Dolinsky, who run their business called Frankendo. The company uses a variation of the famous "Nintendo" logo.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-me6KfZVIYnI/Xl2YTFMeCrI/AAAAAAACgII/JtAMjXpQzxIVS9J8_As_AAItO5faRcC1ACLcBGAsYHQ/s1600/State_of_Israel_anime_animatedfilmreviews.filminspector.com_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Israeli election anime animatedfilmreviews.filminspector.com" border="0" data-original-height="361" data-original-width="640" height="360" itemprop="image" src="https://1.bp.blogspot.com/-me6KfZVIYnI/Xl2YTFMeCrI/AAAAAAACgII/JtAMjXpQzxIVS9J8_As_AAItO5faRcC1ACLcBGAsYHQ/s640/State_of_Israel_anime_animatedfilmreviews.filminspector.com_2.jpg" width="640" /></a></div>
<br />
Benjamin Netanyahu, in particular, is a larger-than-life character, and the anime brings out the qualities that the public has become familiar with during his long service as the Prime Minister of Israel.<br />
<br />
The illustrations in typical anime over-the-top style are by Ophir Sheriff. Two Japanese voice actors also lend their talents.<br />
<br />
Even if you are not too familiar with Israeli politics, this series incorporates an interesting blend of animation styles.<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/Ly4Y4vDPwog" width="640"></iframe></center>
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/VhAM6FkBva8" width="640"></iframe></center>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-xAYKWnYpFLA/Xl2Y5E33OKI/AAAAAAACgIQ/KredSepokGcNbBVH-JPkAgdmxNwoCnEVACLcBGAsYHQ/s1600/State_of_Israel_anime_animatedfilmreviews.filminspector.com_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Israeli election anime animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="360" itemprop="image" src="https://1.bp.blogspot.com/-xAYKWnYpFLA/Xl2Y5E33OKI/AAAAAAACgIQ/KredSepokGcNbBVH-JPkAgdmxNwoCnEVACLcBGAsYHQ/s640/State_of_Israel_anime_animatedfilmreviews.filminspector.com_3.jpg" width="640" /></a></div>
<br />
<span class="updated">2020</span>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-68522187854024308242019-11-27T19:11:00.002-07:002020-03-09T00:04:16.703-06:00Frozen II: Learn More About Anna and Elsa<div itemscope="" itemtype="https://schema.org/Movie">
<h1>
Anna and Elsa Return in a Darker Frozen 2</h1>
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-VZxrySnH8Ro/Xd8PLvHpp5I/AAAAAAACdEs/TfvbVOngmfosneKyvQlBoARW8Nd5nMNbwCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_3.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="360" itemprop="image" src="https://1.bp.blogspot.com/-VZxrySnH8Ro/Xd8PLvHpp5I/AAAAAAACdEs/TfvbVOngmfosneKyvQlBoARW8Nd5nMNbwCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_3.jpg" title="" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">"Frozen II" (2019) features more magic by Elsa (all pictures courtesy of Disney).</td></tr>
</tbody></table>
The long-awaited sequel to the hugely successful animated feature film "Frozen" (2013) finally arrived in <span itemprop="dateCreated">November 2019</span>, and audiences flocked to see it. While the story is slightly different and there are new songs to sing on those road trips, essentially the entire Disney team that created "Frozen" returned for the sequel.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-hryqbRMTjcA/XmXS2ArcCEI/AAAAAAACgWI/-bGfmBfaebQ-_KW2gET7jDnsQsvO1ReYACLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_25.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="260" data-original-width="540" itemprop="image" src="https://1.bp.blogspot.com/-hryqbRMTjcA/XmXS2ArcCEI/AAAAAAACgWI/-bGfmBfaebQ-_KW2gET7jDnsQsvO1ReYACLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_25.gif" /></a></div>
<br />
As you might expect, the experience of watching "Frozen II" thus is similar to watching the original film. Let's take a close look at "<b itemprop="name">Frozen II</b>" both as an individual film the continuation of a franchise.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-IW37lsMIXJ8/Xd8RpqxNPMI/AAAAAAACdFE/U7xJb3bC3UItrpu2Wznp5qYvog0Tw4mYQCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="932" data-original-width="640" height="640" itemprop="image" src="https://1.bp.blogspot.com/-IW37lsMIXJ8/Xd8RpqxNPMI/AAAAAAACdFE/U7xJb3bC3UItrpu2Wznp5qYvog0Tw4mYQCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_5.jpg" width="438" /></a></div>
<br />
<span itemprop="director" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Chris Buck and Jennifer Lee</span></span> directed "Frozen II," and the screenplay was written by Buck, Lee, Marc E. Smith, <span itemprop="musicby" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Kristen Anderson-Lopez, and Robert Lopez</span></span>. It stars <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Idina Menzel</span></span>, <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Kristen Bell</span></span>, <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Jonathan Groff</span></span>, and <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Josh Gad</span></span>. The Lopez husband-and-wife team wrote the songs, while Christopher Beck wrote the score. The "Frozen II" production company was <span itemprop="productionCompany">Walt Disney Animation Studios</span> and Walt Disney Studios Motion Pictures distributed it.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-EDHrmKsFl8M/Xd8SI-UAZHI/AAAAAAACdFM/uwL7BGpret8LlsNdxLCBP4PD3WU0naofgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_6.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="915" data-original-width="640" height="640" itemprop="image" src="https://1.bp.blogspot.com/-EDHrmKsFl8M/Xd8SI-UAZHI/AAAAAAACdFM/uwL7BGpret8LlsNdxLCBP4PD3WU0naofgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_6.jpg" width="446" /></a></div>
<h2>
The Frozen II Storyline</h2>
<span itemprop="description">The events of "Frozen II" are set three years after the conclusion of "Frozen."</span> Queen Elsa, Princess Anna, and their travel team of Kristoff, Olaf, and Sven undertake a journey of exploration from their kingdom of Arendelle.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-AN-ydrOJhEM/Xd8TKVelliI/AAAAAAACdFY/aRol7K1wCbsza-96P_u-6YVDLDd6HxMbACLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_7.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="384" data-original-width="640" height="384" itemprop="image" src="https://1.bp.blogspot.com/-AN-ydrOJhEM/Xd8TKVelliI/AAAAAAACdFY/aRol7K1wCbsza-96P_u-6YVDLDd6HxMbACLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_7.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">King Agnarr with young Elsa and Anna.</td></tr>
</tbody></table>
The story begins in flashback style when King Agnarr (<span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Alfred Molina</span></span>) of Arendelle tells his children Anna (Kristen Bell) and Elsa (Idina Menzel) about their grandfather, King Runeard (<span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Jeremy Sisto</span></span>). Many years earlier, King Runeard established a treaty with the tribe of Northuldra by building a dam where they lived in the Enchanted Forest.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-bNu9Ih8JeSs/XmXS9coSO9I/AAAAAAACgWM/Rumn-epqWrAGJswB34pk0reUgDCFKcFmwCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_26.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="322" data-original-width="512" itemprop="image" src="https://1.bp.blogspot.com/-bNu9Ih8JeSs/XmXS9coSO9I/AAAAAAACgWM/Rumn-epqWrAGJswB34pk0reUgDCFKcFmwCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_26.gif" /></a></div>
<br />
Unfortunately, King Runeard perishes when a fight occurs, and in response, the basic spirits of the elements of earth, air, fire, and water depart the Enchanted Forest. Runeard's son, Agnarr, somehow escapes from the Enchanted Forest with the help of a mysterious entity, but everyone else is trapped there until the basic elements return.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-ssi4Do5Z0Kc/Xd8UBKsGUqI/AAAAAAACdFk/JaXyBF4Eq20HVfcMGPCm3MjCg8E6W_CqgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_8.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="479" data-original-width="640" height="478" itemprop="image" src="https://1.bp.blogspot.com/-ssi4Do5Z0Kc/Xd8UBKsGUqI/AAAAAAACdFk/JaXyBF4Eq20HVfcMGPCm3MjCg8E6W_CqgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_8.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Grand Pabbie gives Elsa some advice.</td></tr>
</tbody></table>
Returning to the present, Queen Elsa hears a mysterious voice calling out to her. She follows its call and accidentally awakens the spirits of the basic elements which had departed from the Enchanted Forest. This causes problems in Arendelle which must be solved, and Grand Pabbie and the Trolls arrive to advise Elsa on what to do. She learns that the only way to make things right in Arendelle is to undertake a journey to learn Arendelle's past and fix things at that destination.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-fEqr6TJPBGY/Xd8WVzo28DI/AAAAAAACdF8/dijSUXHT4Z8M-p0J5fiFAfsJcvlEVo-HgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_10.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="480" data-original-width="640" height="480" itemprop="image" src="https://1.bp.blogspot.com/-fEqr6TJPBGY/Xd8WVzo28DI/AAAAAAACdF8/dijSUXHT4Z8M-p0J5fiFAfsJcvlEVo-HgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_10.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Queen Iduna helps to set things in motion in "Frozen II."</td></tr>
</tbody></table>
So, Elsa and Anna rejoin their travel companions from "Frozen" for the journey. These are Olaf the snowman (Josh Gad), Kristoff the ice harvester (Jonathan Groff), and reindeer Sven. Following the mysterious voice, Elsa leads the team to the Enchanted Forest. They find it enshrouded in mist, but Elsa is able to part it.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-g9jRS5C2nEc/XmXTD_f_U4I/AAAAAAACgWU/NhGJ27Hd6KYWNVmt08VK_0dOTO7Q7kU1QCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_27.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="326" data-original-width="580" itemprop="image" src="https://1.bp.blogspot.com/-g9jRS5C2nEc/XmXTD_f_U4I/AAAAAAACgWU/NhGJ27Hd6KYWNVmt08VK_0dOTO7Q7kU1QCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_27.gif" /></a></div>
<br />
A tornado attacks, but Elsa uses her magic powers to turn it into ice sculptures. These sculptures are images from Agnarr's past and show that his mysterious savior was their mother, Queen Iduna of Northuldra (<span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Evan Rachel Wood</span></span>).<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-OxdSloNGt94/Xd8Q1L8BbRI/AAAAAAACdE4/tnoAUZHLxzkzYtr7CK4pJ_IPzcN5sJn-wCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_4.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="435" data-original-width="640" height="435" itemprop="image" src="https://1.bp.blogspot.com/-OxdSloNGt94/Xd8Q1L8BbRI/AAAAAAACdE4/tnoAUZHLxzkzYtr7CK4pJ_IPzcN5sJn-wCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_4.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">The fire spirit turns out to be a cute salamander.</td></tr>
</tbody></table>
Encountering the Northuldra and some lost Arendellian soldiers who are still fighting each other even after all this time, Elsa and her party are attacked next by the fire spirit. Once again, Elsa is able to stop this attack and calm down the spirit, which turns out to be a magic salamander. This leads to a truce between the warring men of Northuldra and Arendelle. At this time, Elsa learns of the existence of a fifth spirit which may solve Arendelle's problems.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-2frEZRTY9x0/Xd8W8ATBOiI/AAAAAAACdGE/hpWikuPRTaQGZDRQh2joKkNoxNNCVZ-wgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_10.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="320" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-2frEZRTY9x0/Xd8W8ATBOiI/AAAAAAACdGE/hpWikuPRTaQGZDRQh2joKkNoxNNCVZ-wgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_10.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Elsa confronts Nokk, the water spirit, in "Frozen II."</td></tr>
</tbody></table>
Elsa, Anna, and Olaf head north leaving Sven and Kristoff behind. Discovering the wreck of her parents' ship and a map showing a route to Ahtolhallan, a mythical river which is reputed to explain the past, Elsa continues on alone. The water spirit, Nokk, now appears guarding the way to Ahtohallan. Elsa calms him down, too, and continues to the river.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-MH-iVZViQVo/XmXUDJOqzbI/AAAAAAACgWo/KoHCBAoJQWAzbfjn-Kkz1ZzRhFla_Pe5gCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_28.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="224" data-original-width="540" itemprop="image" src="https://1.bp.blogspot.com/-MH-iVZViQVo/XmXUDJOqzbI/AAAAAAACgWo/KoHCBAoJQWAzbfjn-Kkz1ZzRhFla_Pe5gCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_28.gif" /></a></div>
<div class="separator" style="clear: both; text-align: center;">
</div>
<br />
There, Elsa learns that the mysterious voice which initiated their journey was that of her mother, Queen Iduna. She further learns that nature bestowed upon her magic powers due to Iduna's rescue of Agnarr. This makes Elsa the fifth spirit.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-99tnOs9NMos/Xd8XqEMbf0I/AAAAAAACdGM/Bxyc4sAd-30H0C_J9VkVQ_qOhPVIo_4ZQCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_11.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="379" data-original-width="640" height="378" itemprop="image" src="https://1.bp.blogspot.com/-99tnOs9NMos/Xd8XqEMbf0I/AAAAAAACdGM/Bxyc4sAd-30H0C_J9VkVQ_qOhPVIo_4ZQCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_11.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Somewhat ironically, Elsa freezes solid in "Frozen II."</td></tr>
</tbody></table>
Learning more about the past, Elsa discovers that King Runeard only built the dam to hurt Northuldra, which he viewed as a threat due to their use of magic. Runeard himself caused the conflict with Northuldra by killing their leader. Suddenly, Elsa freezes solid due to venturing too far into Ahtohallan, but first, she is able to get a message to Anna. When Elsa freezes, Olaf disappears.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-zk7B8C7yKvI/Xd8YU4zBg2I/AAAAAAACdGU/WuybChuJx4woFHLtGl-zmBP0jBIaaCj6wCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector_com_12.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="320" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-zk7B8C7yKvI/Xd8YU4zBg2I/AAAAAAACdGU/WuybChuJx4woFHLtGl-zmBP0jBIaaCj6wCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector_com_12.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">The earth giant in "Frozen II."</td></tr>
</tbody></table>
Alerted, Anna realizes that the only way to set things right is to destroy the dam. She finds the enormous earth spirit and manages to draw it to the dam. The earth spirit accidentally destroys the dam, which sends water flowing toward Arendelle. However, destroying the dam frees Elsa, who manages to return to Arendelle and stop the flood.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td><a href="https://1.bp.blogspot.com/-j3baz1p_6zc/Xd8U8K23naI/AAAAAAACdFw/pv0nl2RkHGoJgy6Lkx49ZmOjYDE4QLogACLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_9.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="439" data-original-width="640" height="439" itemprop="image" src="https://1.bp.blogspot.com/-j3baz1p_6zc/Xd8U8K23naI/AAAAAAACdFw/pv0nl2RkHGoJgy6Lkx49ZmOjYDE4QLogACLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_9.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="font-size: 19.2px;">Anna and Kristoff in "Frozen II."</td></tr>
</tbody></table>
With the dam broken and the kingdom saved, Elsa and Anna reunite and Olaf returns to life. Kristoff proposes to Anna, who accepts. Elsa decides to abdicate as Queen in order to return to the Enchanted Forest and be its protector. Thus, "Frozen II" ends with Anna as the Queen of Arendelle and Elsa the protector of the Enchanted Forest.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-eKpnK5lUsek/Xd8ZbPJh9oI/AAAAAAACdGg/I6W1OM5IQhgdsMTJlO4iLdwncF82zxB2wCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_14.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="906" data-original-width="640" height="640" itemprop="image" src="https://1.bp.blogspot.com/-eKpnK5lUsek/Xd8ZbPJh9oI/AAAAAAACdGg/I6W1OM5IQhgdsMTJlO4iLdwncF82zxB2wCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_14.webp" width="452" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">The prominent "Frozen II" billboard in Hollywood places Anna in a distinctly secondary position and gives Elsa a sinister appearance.</td></tr>
</tbody></table>
<h2>
The Impact of Frozen II</h2>
"Frozen II" greatly expands upon the "Frozen" universe and gives it context. Elsa's magic powers now have an explanation and both Anna and Elsa have specific roles to play with important purposes to maintain peace. In that sense, "Frozen II" is a fitting companion to "Frozen" and not just a completely new adventure using the same characters. "Frozen II" is a beautiful film with new animation techniques which give the character of Nokki a realistic liquid-like appearance. The storyline is a bit darker, with some subthemes that seem misplaced in a children's film. Overall, as a sequel, "Frozen II" is quite worthy of the original film.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-KXLjg3iBCtM/Xd8a06WUcKI/AAAAAAACdGs/Oqbf7_V6uLcoEF5qmYWJPVvwW-uGj4fmgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_15.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="420" data-original-width="640" height="420" itemprop="image" src="https://1.bp.blogspot.com/-KXLjg3iBCtM/Xd8a06WUcKI/AAAAAAACdGs/Oqbf7_V6uLcoEF5qmYWJPVvwW-uGj4fmgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_15.webp" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Another "Frozen II" billboard dispenses with the secondary characters altogether. Advertising like this seems to be saying, "I'm back, and boy and I mad."</td></tr>
</tbody></table>
No film is perfect, and that includes "Frozen II." The story is engaging, but not as original as the original "Frozen." The storyline is a bit sketchy, focusing on a "sins of the fathers" theme which is darker than the original film. The screenwriters seem determined to shoehorn in environmental issues that are a bit preachy. Implying that dams are bad is weird and inexplicable, but perhaps that is taken as a given in California where "Frozen II" was produced. Are dams intrinsically bad things that rob people of natural resources? That's an underlying premise that must seem perfectly mainstream to the filmmakers (or perhaps they just want it to be mainstream). Also, blaming the kingdom of Arendelle and its leaders for wreaking havoc on others also raises some potentially intriguing moral questions that are completely glossed over.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-Gk717rh1rwU/Xd8rfr5cy9I/AAAAAAACdHg/vQfBSrCdG00hp-Zi1HzT44h3GUCPgN-KACLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_20.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="427" data-original-width="640" height="427" itemprop="image" src="https://1.bp.blogspot.com/-Gk717rh1rwU/Xd8rfr5cy9I/AAAAAAACdHg/vQfBSrCdG00hp-Zi1HzT44h3GUCPgN-KACLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_20.webp" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Elsa learns the dark secret of Arendelle in "Frozen II."</td></tr>
</tbody></table>
The original source material for "Frozen," Hans Christian Anderson's "The Snow Queen," was very dark and not at all the whimsical tales of derring-do that the "Frozen" films became. There are hints that the "Frozen" films are edging back toward that serious quality, and this is reflected in Elsa's grim expression and defiant attitude on billboards and in other advertising. Darkness always has hovered over Disney animated feature films, with witches destroyed, people such as Cinderella treated poorly, and, most famously, the shocking ending of "Bambi." In "Frozen II," good things happen because things are destroyed and powerful creatures are subdued. The lasting consequences of bad choices are portrayed at length, though affixing blame is absent. There is a definite moral subtext to "Frozen II" which keeps trying to burst out from beneath the colorful animation and happy ending.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-qNd3fleg1a4/Xd8bXOvA97I/AAAAAAACdG0/wv4caRM8sB0mDbEtbnwoWXLDvzhRFX4-QCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_16.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="468" data-original-width="640" height="466" itemprop="image" src="https://1.bp.blogspot.com/-qNd3fleg1a4/Xd8bXOvA97I/AAAAAAACdG0/wv4caRM8sB0mDbEtbnwoWXLDvzhRFX4-QCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_16.webp" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Anna and Olaf go for a ride in "Frozen II."</td></tr>
</tbody></table>
The "Frozen II" songs are catchy, but there are no breakout hits like "Let It Go." The characters are fun, but they were more fun and original in "Frozen." The absence of a true villain drains "Frozen II" of tension. You have to really care about Anna and Elsa for "Frozen II" to matter to you, and that is unlikely unless you are a fan of "Frozen" to begin with. The bottom line is that "Frozen II" is best seen as a pedestrian continuation film and not one that can stand alone on its own merits as a masterpiece. While this is a typical issue with sequels, "Frozen II" does not really hit new heights of greatness which some sequels manage to do by recalibrating the entire spirit of the franchise. This was the case for "Star Trek II: The Wrath of Khan" and "Godfather II," for instance, but not "Frozen II."<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-oLTdBXFuGnk/Xd8b47xy1BI/AAAAAAACdG8/mtaVu35VLhI-8Y7f-SVWHWVUsRrk8XSIgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_17.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="360" itemprop="image" src="https://1.bp.blogspot.com/-oLTdBXFuGnk/Xd8b47xy1BI/AAAAAAACdG8/mtaVu35VLhI-8Y7f-SVWHWVUsRrk8XSIgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_17.webp" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">It's all about Elsa in "Frozen II."</td></tr>
</tbody></table>
Regardless of quibbles, audiences quickly made "Frozen II" a success. "Frozen II" proved particularly popular with girls and women while also drawing a good crowd of boys and men. It had the highest opening for an animated film of all time and most viewers seemed to like it as much as the original. Based on its opening weekend, "Frozen II" appeared likely to match the box office performance of "Frozen." It quickly set records for the best opening of all time for an animated feature film in France and the United Kingdom, and the best opening for a Disney or Pixar film in China, Japan, Germany, and Spain. There is no question that "Frozen II" is a success and that Disney was wise to make it.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-HFHHqvHMpok/Xd8eoVz6ZvI/AAAAAAACdHI/VzjTP5cw5FUVqf5a8b59gAJZz_V34UDSACLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_18.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="540" height="213" itemprop="image" src="https://1.bp.blogspot.com/-HFHHqvHMpok/Xd8eoVz6ZvI/AAAAAAACdHI/VzjTP5cw5FUVqf5a8b59gAJZz_V34UDSACLcBGAsYHQ/s320/Frozen_II_animatedfilmreviews.filminspector.com_18.gif" width="320" /></a></div>
<br />
<h2>
Conclusion</h2>
Everyone experiences film differently, which is part of their magic. Personally, to this viewer, "Frozen II" was a bit underwhelming. It did not capture the magic of the original "Frozen," admittedly a groundbreaking film that managed to capture the public's imagination and become a cultural touchstone. Those types of experiences are very rare. I am not in the target demographic, while "Frozen II" is virtually obligatory viewing for tween girls. I can only say that the craftsmanship is there and "Frozen 2" does what it sets out to do: add a new chapter to the continuing saga of Anna and Elsa. And, it does so in a superior but hardly groundbreaking visual style. Anyone who wants more of the same likely will be pleased, but expecting the same kind of exciting experience of the original, which was fresh and new, is likely to lead you only to disappointment.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-s35GxeBazxE/XmXU6WWUKXI/AAAAAAACgW0/ldJnTIjTw6khj0q-vCUp1Myw6_CVwsYzgCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_30.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="540" itemprop="image" src="https://1.bp.blogspot.com/-s35GxeBazxE/XmXU6WWUKXI/AAAAAAACgW0/ldJnTIjTw6khj0q-vCUp1Myw6_CVwsYzgCLcBGAsYHQ/s1600/Frozen_2_animatedfilmreviews.filminspector.com_30.gif" /></a></div>
<br />
The creators of "Frozen II" know their intended audience and oriented things with that in mind without taking too many creative chances. There is nothing groundbreaking in "Frozen II." In fact, "Frozen II" is exactly the type of sequel that you would expect when the powers-that-be don't want to tinker with a winning formula. If you saw the original "Frozen," you know exactly what to expect in "Frozen II."<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-48Zb2GFe2-o/Xd8ljVJkaBI/AAAAAAACdHU/1sPiDEviTMQcUZpTIQV0jC2RJSox1PdxgCLcBGAsYHQ/s1600/Frozen_II_animatedfilmreviews.filminspector.com_19.webp" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen II animatedfilmreviews.filminspector.com" border="0" data-original-height="425" data-original-width="640" height="424" itemprop="image" src="https://1.bp.blogspot.com/-48Zb2GFe2-o/Xd8ljVJkaBI/AAAAAAACdHU/1sPiDEviTMQcUZpTIQV0jC2RJSox1PdxgCLcBGAsYHQ/s640/Frozen_II_animatedfilmreviews.filminspector.com_19.webp" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Elsa and Anna, together again.</td></tr>
</tbody></table>
In terms of impact, I place "Frozen II" squarely in the company of "Toy Story 4" and "Ghostbusters II." These types of films simply place the same characters into new adventures as audiences expect. In sum, "Frozen II" is more of the same, which isn't a bad thing in a franchise as warmly received as the world of "Frozen."<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/bwzLiQZDw2I" width="640"></iframe></center>
<br />
<span class="updated">2020</span>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-15183440607958749622019-06-11T10:02:00.001-06:002020-03-08T23:17:39.665-06:00Frozen 2 Trailer is Out!<div itemscope="" itemtype="https://schema.org/Movie">
<h1>
Frozen 2 Coming Into View</h1>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-Pnor7UZM-uc/XP_MzaZqbZI/AAAAAAACY_s/QE0hhJ3qEhAZfD8pTkNS9R3xRlvGvgYIACLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_15.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="598" data-original-width="640" height="597" itemprop="image" src="https://1.bp.blogspot.com/-Pnor7UZM-uc/XP_MzaZqbZI/AAAAAAACY_s/QE0hhJ3qEhAZfD8pTkNS9R3xRlvGvgYIACLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_15.jpg" title="" width="640" /></a></div>
<br />
"<b itemprop="name">Frozen 2</b>" is guaranteed to be one of the biggest animation feature film successes of all time. <span itemprop="productionCompany">Walt Disney Animation Studios</span> has produced "Frozen 2."<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/rPHh2lrmZrM" width="640"></iframe></center>
<br />
The "Frozen" films follow the two royal sisters Queen Elsa and Princess Anna of the kingdom of Arendelle. Elsa is voiced by Idina Menzel and Kristen is voiced by Kristen Bell.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-sUY7MlW66A0/XP_M0wya9EI/AAAAAAACY_4/zr-6GqPlTWIKi6pjrUBmPeroB6U2xTFxgCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_7.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="776" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-sUY7MlW66A0/XP_M0wya9EI/AAAAAAACY_4/zr-6GqPlTWIKi6pjrUBmPeroB6U2xTFxgCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_7.jpg" width="263" /></a></div>
<br />
Plot details for "Frozen 2" have not been released. However, that hasn't stopped people from speculating on the plot based upon the trailers released so far.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-B6va_A4xf3A/XP_M1Ua6TxI/AAAAAAACY_8/Pqs3OymB5ZwquOyL3uk7MVLK0EoHo0opACLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_8.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="558" data-original-width="640" height="279" itemprop="image" src="https://1.bp.blogspot.com/-B6va_A4xf3A/XP_M1Ua6TxI/AAAAAAACY_8/Pqs3OymB5ZwquOyL3uk7MVLK0EoHo0opACLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_8.jpg" width="320" /></a></div>
<br />
It is thought that the two sisters engage on a journey to explore the origins of Elsa's icy magical powers.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-xgZZ2NDB3CQ/XP_M16YexPI/AAAAAAACZAA/PARshwuBLPcGzcBswz55YHSwl0mt6YyMgCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_9.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="255" data-original-width="640" height="127" itemprop="image" src="https://1.bp.blogspot.com/-xgZZ2NDB3CQ/XP_M16YexPI/AAAAAAACZAA/PARshwuBLPcGzcBswz55YHSwl0mt6YyMgCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_9.jpg" width="320" /></a></div>
<br />
There also is some kind of threat looming over Arendelle.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-b0PeS2ckiSU/XP_MyE9TS1I/AAAAAAACY_Y/kSFN6Sj2ODomCFcnIOf2ddk6iVGIdMlUwCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_10.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="611" data-original-width="640" height="305" itemprop="image" src="https://1.bp.blogspot.com/-b0PeS2ckiSU/XP_MyE9TS1I/AAAAAAACY_Y/kSFN6Sj2ODomCFcnIOf2ddk6iVGIdMlUwCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_10.jpg" width="320" /></a></div>
<br />
Most of the characters from the original "Frozen" reprise their roles in "Frozen 2."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-6EBSLYmkJUw/XP_MyH7oX1I/AAAAAAACY_c/nk1P0EKkCN4DruyDZ8d4aPHcvIybbFMFwCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_11.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="331" data-original-width="640" height="165" itemprop="image" src="https://1.bp.blogspot.com/-6EBSLYmkJUw/XP_MyH7oX1I/AAAAAAACY_c/nk1P0EKkCN4DruyDZ8d4aPHcvIybbFMFwCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_11.jpg" width="320" /></a></div>
<br />
The trailer for "Frozen 2" released in February 2019 became the most-watched trailer for an animated movie of all time.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-4gLWzDsQWPw/XP_MyG2aAvI/AAAAAAACY_g/IZi-kXl4JwU1vNwS8dZwTZWWV1KUK_dLACLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_12.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="489" data-original-width="640" height="244" itemprop="image" src="https://1.bp.blogspot.com/-4gLWzDsQWPw/XP_MyG2aAvI/AAAAAAACY_g/IZi-kXl4JwU1vNwS8dZwTZWWV1KUK_dLACLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_12.jpg" width="320" /></a></div>
<br />
In fact, the February 2019 "teaser" trailer accumulated 113.6 million views in its first 24 hours.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-sJO_7h8H7QY/XP_Mypy19aI/AAAAAAACY_k/TMweWG2e_kUJOyjjkn4f4tekwiaeMo1AwCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_13.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="548" data-original-width="640" height="274" itemprop="image" src="https://1.bp.blogspot.com/-sJO_7h8H7QY/XP_Mypy19aI/AAAAAAACY_k/TMweWG2e_kUJOyjjkn4f4tekwiaeMo1AwCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_13.jpg" width="320" /></a></div>
<br />
"Frozen" grossed over $1 billion worldwide after its release in 2013.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-g2qnInCzBxA/XP_My_c49AI/AAAAAAACY_o/Cx_Fph0JeTcec4RC-1HJBj-cikt0x1czwCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_14.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="400" data-original-width="640" height="200" itemprop="image" src="https://1.bp.blogspot.com/-g2qnInCzBxA/XP_My_c49AI/AAAAAAACY_o/Cx_Fph0JeTcec4RC-1HJBj-cikt0x1czwCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_14.jpg" width="320" /></a></div>
<br />
Among those returning in "Frozen 2" are Jonathan Groff as Kristoff, Josh Gad as Olaf, and Santino Fontana as Hans.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/--xcKOeTaCTU/XP_Mz2PlHiI/AAAAAAACY_w/V2WTy0enc2k2AbkQn41Pp7CKiA5Lj0CGQCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_16.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="560" data-original-width="640" height="280" itemprop="image" src="https://1.bp.blogspot.com/--xcKOeTaCTU/XP_Mz2PlHiI/AAAAAAACY_w/V2WTy0enc2k2AbkQn41Pp7CKiA5Lj0CGQCLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_16.jpg" width="320" /></a></div>
<br />
"Frozen 2" appears in US theaters on 22 November 2019.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-4sgA8PPjP_I/XP_M0XSR99I/AAAAAAACY_0/Wtmgq33cngom9x96ujFiUR8FCOZcQDVDACLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_17.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 trailer animatedfilmreview.filminspector.com" border="0" data-original-height="275" data-original-width="640" height="137" itemprop="image" src="https://1.bp.blogspot.com/-4sgA8PPjP_I/XP_M0XSR99I/AAAAAAACY_0/Wtmgq33cngom9x96ujFiUR8FCOZcQDVDACLcBGAs/s320/Frozen_2_animatedfilmreviews.filminspector.com_17.jpg" width="320" /></a></div>
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/eSLe4HuKuK0" width="640"></iframe></center>
<br />
<span class="updated">2020</span></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-85153337447670389112019-02-13T16:18:00.000-07:002020-03-08T23:16:11.783-06:00First Trailer for Frozen 2<div itemscope="" itemtype="https://schema.org/Movie">
<h1>
Frozen 2 Official Trailer!</h1>
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://2.bp.blogspot.com/-gOzmpZ4JS9g/XGSiKYcmIOI/AAAAAAACVus/dq3hzLDtdcQR38pdyAKxxsSh1_I3S6g_gCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_1.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="480" data-original-width="640" height="480" itemprop="image" src="https://2.bp.blogspot.com/-gOzmpZ4JS9g/XGSiKYcmIOI/AAAAAAACVus/dq3hzLDtdcQR38pdyAKxxsSh1_I3S6g_gCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_1.jpg" title="Anna, Elsa, and Kristoff" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Elsa, Anna, and Kristoff in "Frozen 2."</td></tr>
</tbody></table>
"<b itemprop="name">Frozen 2</b>" is due to hit theaters on <span itemprop="dateCreated">22 November 2019</span> (at least in the United States). It is 2019 already (as you may have noticed), so Disney has begun the official roll-out for the release. That means the Official Teaser Trailer has been released (see below) today, 13 February 2019.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-F4OFxg5bgbU/XGSipsXVqBI/AAAAAAACVu0/GDEHzwG1_PoTGIBKj9Ligz6d6MiUDk4AQCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="337" data-original-width="640" height="336" itemprop="image" src="https://2.bp.blogspot.com/-F4OFxg5bgbU/XGSipsXVqBI/AAAAAAACVu0/GDEHzwG1_PoTGIBKj9Ligz6d6MiUDk4AQCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_2.jpg" title="Anna and Elsa in "Frozen 2."" width="640" /></a></div>
<br />
It typically takes Disney more or less five years to produce an animated feature film, so the six years between the original "Frozen" in 2013 and "Frozen 2" in 2019 is about what we've been expecting. The same crew is coming back to do the sequel, which includes all the main voice actors such as <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Kristin Bell</span></span> and <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Josh Gad and all the rest</span></span>. "Frozen 2" has the same directors (<span itemprop="director" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Chris Buck and Jennifer Lee</span></span>), the same songwriters (<span itemprop="musicby" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Robert Lopez and Kristen Anderson-Lopez</span></span>), the same characters, the same voice actors, the same screenwriter (Lee, along with "assistance" from veteran Disney writer Christopher Robin)... you get the picture. There's a lot of sameness to the production. It remains to be seen how much sameness there is in the plot and the songs and everything else. That could be good in some ways and perhaps not good in other ways.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-JlXH7sU7VDY/XGSjCJQLhMI/AAAAAAACVvA/05jm-_PYvxYO8cSmB0w92497bBg7dr_DQCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="341" data-original-width="640" height="341" itemprop="image" src="https://4.bp.blogspot.com/-JlXH7sU7VDY/XGSjCJQLhMI/AAAAAAACVvA/05jm-_PYvxYO8cSmB0w92497bBg7dr_DQCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_3.jpg" title="Anna and Elsa in "Frozen 2."" width="640" /></a></div>
<br />
The biggest change to report since "Frozen" is that John K. Lasseter is no longer chief creative officer of Disney Animation. He was replaced by... Lee. And that again tells you how much sameness there is likely to be between "Frozen" and "Frozen 2." Yes, we are a bit skeptical about "Frozen 2" breaking new creative ground, but time will tell. The audience - meaning you - will decide whether "Frozen 2" is a creative success. Since you liked the original "Frozen," and there's a lot of sameness to "Frozen 2," you'll probably like the sequel, too. That's just how these things go, Hollywood is very good at making sequels.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-m25LQm3o17k/XGSj7XnvxKI/AAAAAAACVvU/vC59fYklXmU6kYEZC6fB5fszikIEyPD6wCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="396" data-original-width="640" height="396" itemprop="image" src="https://4.bp.blogspot.com/-m25LQm3o17k/XGSj7XnvxKI/AAAAAAACVvU/vC59fYklXmU6kYEZC6fB5fszikIEyPD6wCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_5.jpg" title="Elsa in Frozen 2." width="640" /></a></div>
<br />
It's fun to speculate, so let's speculate about the "Frozen 2" plot. It's probably a good bet that someone either is lost or in trouble or storms off in a huff and has to be retrieved. Then, the others have to go find that person or people. Perhaps our fearless trio set off to find Anna's and Elsa's parents who are lost at sea. Perhaps the parents have been imprisoned by some big monster somewhere and Elsa has to change the weather to free them. In any event, there will be some kind of quest involved, else this wouldn't be a sequel.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-MVggYDHp4ZA/XGSpVIYnqII/AAAAAAACVvg/9XhDtkTkxss9YDbPJK5dJ5W3BaXt4pXUwCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_6.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="269" data-original-width="640" height="268" itemprop="image" src="https://1.bp.blogspot.com/-MVggYDHp4ZA/XGSpVIYnqII/AAAAAAACVvg/9XhDtkTkxss9YDbPJK5dJ5W3BaXt4pXUwCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_6.jpg" title="Elsa in "Frozen 2."" width="640" /></a></div>
<br />
We'll continue to keep you posted on "Frozen 2" developments. The trailers are absolutely rock-solid certain to get gazillions of views and the film itself will make a ton of money. "Frozen 2" will win the Best Animation Film award at the 2020 Oscars, you may as well just write that down right now, the fan base is just too intense. Bottom line, if you liked "Frozen," you'll likely want to see "Frozen 2." The trailer for "Frozen 2" looks... similar to "Frozen." But it's different than "Frozen" because it's not the trailer for "Frozen." We'll have to wait to see how original the film itself is.<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/eSLe4HuKuK0" width="640"></iframe></center>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-Be4DwNjumn4/XGSjdpw-TxI/AAAAAAACVvI/wXFC2LDKEjo9BOUqkPAAEH4290bwsaGWgCLcBGAs/s1600/Frozen_2_animatedfilmreviews.filminspector.com_4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Frozen 2 animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="360" itemprop="image" src="https://3.bp.blogspot.com/-Be4DwNjumn4/XGSjdpw-TxI/AAAAAAACVvI/wXFC2LDKEjo9BOUqkPAAEH4290bwsaGWgCLcBGAs/s640/Frozen_2_animatedfilmreviews.filminspector.com_4.jpg" title="Promo for "Frozen 2."" width="640" /></a></div>
<br />
<span class="updated">2020</span></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-27644308171472929802018-12-01T10:58:00.002-07:002020-03-08T23:15:16.690-06:002018 Holiday Special Schedule - Complete List<div itemscope="" itemtype="https://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-AGRDI3L_QFo/XALHYJpuz0I/AAAAAAACTfE/kE387WUfR206FZOQwfLuUQk9sGAP4GkxwCLcBGAs/s1600/Flintstones_Christmas_1a.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Flintstone Christmas animatedfilmreviews.filminspector.com" border="0" data-original-height="498" data-original-width="640" height="249" itemprop="image" src="https://1.bp.blogspot.com/-AGRDI3L_QFo/XALHYJpuz0I/AAAAAAACTfE/kE387WUfR206FZOQwfLuUQk9sGAP4GkxwCLcBGAs/s320/Flintstones_Christmas_1a.jpg" title="" width="320" /></a></div>
<br />
Here is a list of <b itemprop="name">holiday specials for 2018</b>. The station and a few pertinent details are included. If you are looking for something in particular, do a Control-F search and type in a key word, like "Grinch." The best way to use this exhaustive list is to pick a day and look through the listings or look for a specific show using the Control-F method.<br />
<br />
Just to help your search: if you are looking for the classic Rankin/Bass Rudolph the Red-Nosed Reindeer (1964), it airs on Saturday, 8 December 2018 on CBS. "A Charlie Brown Christmas" airs on Thursday, 6 December 2018 on ABC at 8pm, and also on ABC on 20 December 2018 at 8 p.m. So, you get two shots at it, which is unusual.<br />
<br />
"A Christmas Story" airs on TBS throughout the month, with a Christmas Eve marathon.<br />
<br />
"Dr. Seuss’ How the Grinch Stole Christmas" (1966 cartoon) airs on TBS on Thursday, 6 December 2018 at 8 pm as well, but it also airs on NBC on Christmas Day, 25 December 2018 at 8 p.m. also. The Jim Carrey version airs repeatedly throughout the month.<br />
<br />
Anyway, please check your local listings.<br />
<br />
<b>Saturday, December 1</b><br />
Freeform’s 25 Days of Christmas Begins!<br />
Rankin/Bass Animated Christmas Specials on AMC today!<br />
Most of the shows you loved on Freeform are on AMC now, check out their listings!<br />
5:00am – The Jamie Foxx Show (BET)<br />
5:00am – Annie Claus is Coming to Town (2011) (Hallmark Movies)<br />
6:00am – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
6:00am – Nine Lives of Christmas (2014, Brandon Routh) (Hallmark)<br />
6:00am – Small Town Big Deal (RFDTV)<br />
7:00am – Santa Paws 2: The Santa Pups (Freeform)<br />
7:00am – Christmas in Angel falls (2017, Rachel Boston, Beau Bridges) (Hallmark Movies)<br />
7:00am – Christmas Mail (2010) (UP)<br />
7:15am – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
7:30am – DuckTales (Disney)<br />
7:45am – Teen Titans Go! (Cartoon Network)<br />
8:00am – That ’70s Show (Comedy Central)<br />
8:00am – Royal Christmas (2014, Lacey Chabert, Jane Seymour) (Hallmark)<br />
8:30am – Rudolph & Frosty’s Christmas in July (1979, Rankin/Bass) (AMC)<br />
9:00am – Mickey’s Once Upon a Christmas (1999) (Disney)<br />
9:00am – A Joyous Christmas (2017) (Hallmark Movies)<br />
9:00am – Guess Who’s Coming to Christmas (2013, Drew Lachey) (UP)<br />
9:05am – Home Alone 3 (Freeform)<br />
9:31am – The Fresh Prince of Bel-Air (BET)<br />
10:00am – Muppet Babies (Disney Jr)<br />
10:00am – Christmas in Love (2018) (Hallmark)<br />
10:30am – Krampus (2015, Horror) (FXX)<br />
11:00am – The Little Drummer Boy: Book II (1976, Rankin/Bass) (AMC)<br />
11:00am – A Heavenly Christmas (2016, Kristin Davis, Eric McCormack) (Hallmark Movies)<br />
11:00am – Naughty & Nice (2014) (UP)<br />
11:10am – I’ll Be Home for Christmas (1998, Jonathan Taylor Thomas) (Freeform)<br />
11:30am – The Story of the First Christmas Snow (1975, Rankin/Bass) (AMC)<br />
11:30am – Mickey’s Twice Upon a Christmas (2004) (Disney Jr)<br />
12:00pm – The Life and Adventures of Santa Claus (1985, Rankin/Bass) (AMC)<br />
12:00pm – Christmas Everlasting (2018, Tatyana Ali, Patti LaBelle) (Hallmark)<br />
12:00pm – Fixer Upper (HGTV)<br />
12:00pm – Christmas in Mississippi (2017, Faith Ford) (Lifetime)<br />
12:00pm – Meet Me in St. Lous (1944, Judy Garland) (TCM)<br />
1:00pm – A Princess for Christmas (2011, Sir Roger Moore) (Hallmark Movies)<br />
1:00pm – The Rooftop Christmas Tree (2016) (UP)<br />
1:15pm – The Leprechauns’ Christmas Gold (1981, Rankin/Bass) (AMC)<br />
1:15pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
1:15pm – A Bad Moms Christmas (2017, Mila Kunis, Kristen Bell) (Showtime 2)<br />
1:45pm – Nestor, the Long-Eared Christmas Donkey (1977, Rankin/Bass) (AMC)<br />
2:00pm – The Sweetest Christmas (2017, Lacey Chabert) (Hallmark)<br />
2:00pm – Christmas Perfection (2018) (Lifetime)<br />
2:00pm – Four Weddings (TLC)<br />
2:15pm – Jack Frost (1979, Rankin/Bass) (AMC)<br />
2:20pm – Surviving Christmas (2004, Ben Affleck) (HBO)<br />
2:29pm – Inspector Gadget Saves Christmas (Starz Kids)<br />
3:00pm – The Christmas Card (2006, Ed Asner) (Hallmark Movies)<br />
3:20pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
3:30pm – Frosty’s Winter Wonderland (1976, Rankin/Bass) (AMC)<br />
4:00pm – ‘Twas the Night Before Christmas (1974, Rankin/Bass) (AMC)<br />
4:00pm – It’s Christmas, Eve (2018, LeAnn Rimes) (Hallmark)<br />
4:00pm – Poinsettias for Christmas (2018, John Schneider) (Lifetime)<br />
4:25pm – The Nightmare Before Christmas (1993) (Disney XD)<br />
4:30pm – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
5:00pm – Miracle ay Sage Creek (2005) (BYUTV)<br />
5:00pm – Romance at Reindeer Lodge (2017) (Hallmark Movies)<br />
5:00pm – Love Actually (2003, Hugh Grant) (TBS)<br />
5:00pm – My One Christmas Wish (2015) (UP)<br />
5:25pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
5:45pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
6:00pm – Mickey’s Once Upon a Christmas (1999) (Disney Jr)<br />
6:00pm – A Very Harold & Kumar 3D Christmas (2011, Neil Patrick Harris) (FXX)<br />
6:00pm – A Shoe Addict’s Christmas (2018, Candace Cameron-Bure) (Hallmark)<br />
6:00pm – A Very Nutty Christmas (2018, Melissa Joan Hart) (Lifetime)<br />
7:00pm – Elf (2003, Will Ferrell) (AMC)<br />
7:00pm – Christmas Under the Stars (BYUTV)<br />
7:00pm – Finding Christmas (2013) (Hallmark Movies)<br />
7:00pm – Husband for Christmas (2016) (UP)<br />
7:10pm – All is Bright (2013, Paul Giamatti, Paul Rudd) (HDNET Movies)<br />
7:35pm – The Nightmare Before Christmas (1993) (Freeform)<br />
8:00pm – Disney Parks Presents a 25 Days of Christmas Holiday Party (Disney)<br />
8:00pm – The Night Before (2015, Seth Rogan, Joseph Gordon-Levitt) (FXX)<br />
8:00pm – Mingle All the Way (2018) (Hallmark)<br />
8:00pm – A Twist of Christmas (2018) (Lifetime)<br />
8:00pm – A Bad Moms Christmas (2017, Mila Kunis, Kristen Bell) (Showtime 2)<br />
8:00pm – Beyond Tomorrow (1940, Harry Carey) (TCM)<br />
8:55pm – Muppet Babies (Disney Jr)<br />
9:00pm – Elf (2003, Will Ferrell) (AMC)<br />
9:00pm – Christmas Wonderland (2018) (Hallmark Movies)<br />
9:00pm – A Christmas Cruise (2017) (UP)<br />
9:00pm – Tyler Perry’s A Madea Christmas (2013) (USA)<br />
9:15pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
9:30pm – The Dailey & Vincent Show (RFDTV)<br />
9:45pm – The Bishop’s Wife (1947, Cary Grant) (TCM)<br />
10:00pm – The Night Before (2015, Seth Rogan, Joseph Gordon-Levitt) (FXX)<br />
10:00pm – Pride, Prejudice, and Mistletoe (2018, Lacey Chabert) (Hallmark)<br />
10:00pm – Love for Christmas (Lifetime)<br />
10:00pm – Mollie B Polka Party (RFDTV)<br />
10:03pm – A Golden Christmas 3 (2012) (UP)<br />
11:00pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
11:00pm – Christmas with Holly (2012) (Hallmark Movies)<br />
11:00pm – Chandler Christmas Getaway (2018) (UP)<br />
11:15pm – Black Christmas (1974, Margot Kidder, Horror) (Showtime Beyond)<br />
12:00am – A Very Harold & Kumar 3D Christmas (2011, Neil Patrick Harris) (FXX)<br />
12:00am – The Christmas Cottage (2017, Merritt Patterson) (Hallmark)<br />
12:00am – The King of Queens (TV Land)<br />
12:01am – A Twist of Christmas (2018) (Lifetime)<br />
12:15am – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
12:30am – The King of Queens (TV Land)<br />
1:00am – Operation Christmas (2016) (Hallmark Movies)<br />
1:00am – The Goldbergs (Pop)<br />
1:00am – My One Christmas Wish (2015) (UP)<br />
1:30am – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
2:00am – Christmas in Homestead (2016) (Hallmark)<br />
2:04am – A Golden Christmas 3 (2012) (UP)<br />
3:00am – A Christmas to Remember (2016, Mira Sorvino, Cameron Mathison) (Hallmark Movies)<br />
3:45am – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
4:00am – A Rose for Christmas (2017, Rachel Boston) (Hallmark)<br />
4:00am – Message in a Baby (TBN)<br />
4:15am – Family Matters (BET Her)<br />
<br />
<b>Sunday, December 2 </b><br />
5:00am – Sound of Christmas (2016) (Hallmark Movies)<br />
5:00am – Everybody Loves Raymond (TBS)<br />
6:00am – Nestor, the Long-Eared Christmas Donkey (1977, Rankin/Bass) (AMC)<br />
6:00am – The Most Wonderful Time of the Year (2008, Henry Winkler) (Hallmark)<br />
6:30am – Rudolph & Frosty’s Christmas in July (1979, Rankin/Bass) (AMC)<br />
6:30am – It Happened on Fifth Avenue (1947) (TCM)<br />
7:00am – Home Alone 3 (1997) (Freeform)<br />
7:00am – The Christmas Card (2006, Ed Asner) (Hallmark Movies)<br />
8:00am – Christmas Cookies (2016, Jill Wagner) (Hallmark)<br />
8:30am – A Christmas Carol (1938, Reginald Owen) (TCM)<br />
9:00am – Frosty’s Winter Wonderland (1976, Rankin/Bass) (AMC)<br />
9:00am – Eight Crazy Nights (2002, Adam Sandler) (Freeform)<br />
9:00am – Last Vermont Christmas (2018) (Hallmark Movies)<br />
9:30am – ‘Twas the Night Before Christmas (1974, Rankin/Bass) (AMC)<br />
10:00am – The Little Drummer Boy: Book II (1976, Rankin/Bass) (AMC)<br />
10:00am – Miss Christmas (2017) (Hallmark)<br />
10:30am – The Story of the First Christmas Snow (1975, Rankin/Bass) (AMC)<br />
11:00am – Pinocchio’s Christmas (1980, Rankin/Bass) (AMC)<br />
11:00am – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
11:00am – Christmas on Honeysuckle Lane (2018, Alicia Witt) (Hallmark Movies)<br />
12:00pm – Road to Christmas (2018) (Hallmark)<br />
12:15pm – The Leprechauns’ Christmas Gold (1981, Rankin/Bass) (AMC)<br />
12:45pm – Nestor, the Long-Eared Christmas Donkey (1977, Rankin/Bass) (AMC)<br />
1:00pm – A Godwink Christmas (2018, Kathie Lee Gifford) (Hallmark Movies)<br />
1:05pm – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
1:15pm – Jack Frost (1979, Rankin/Bass) (AMC)<br />
2:00pm – Christmas at the Palace (2018, Merritt Patterson) (Hallmark)<br />
2:00pm – Fred Claus (2007, Vince Vaughn) (TBS)<br />
2:30pm – Frosty’s Winter Wonderland (1976, Rankin/Bass) (AMC)<br />
3:00pm – ‘Twas the Night Before Christmas (1974, Rankin/Bass) (AMC)<br />
3:00pm – Karen Kingsbury’s Maggie’s Christmas Miracle (2017, Jill Wagner) (Hallmark Movies)<br />
3:30pm – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
4:00pm – A Gift to Remember (2017, Ali Liebert) (Hallmark)<br />
4:30pm – Love Actually (2003, Hugh Grant) (TBS)<br />
4:40pm – The Nightmare Before Christmas (1993) (Freeform)<br />
4:45pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
5:00pm – Return to Christmas Creek (2018, Steven Weber) (Hallmark Movies)<br />
6:00pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
6:00pm – Mingle All the Way (2018) (Hallmark)<br />
6:20pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
7:00pm – Christmas Wonderland (2018) (Hallmark Movies)<br />
7:00pm – Christmas Catch (UP)<br />
<br />
8:00pm – A Majestic Christmas (2018, Jerrika Hinton) (Hallmark)<br />
8:00pm – The Christmas Pact (Lifetime)<br />
8:00pm – The Shop Around the Corner (1940, James Stewart) (TCM)<br />
8:15pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
9:00pm – Once Upon a Christmas Miracle (2018) (Hallmark Movies)<br />
9:00pm – A Christmas in Vermont (UP)<br />
10:00pm – The Victoria’s Secret Fashion Show Holiday Special (ABC)<br />
10:00pm – Finding Santa (2017, Jodie Sweetin) (Hallmark)<br />
10:00pm – A Star for Christmas (Lifetime)<br />
10:00pm – Holiday Affair (1949, Robert Mitchum) (TCM)<br />
10:30pm – Jingle All the Way (1996, Arnold Schwarzenegger) (AMC)<br />
11:00pm – The Holiday (2006, Cameron Diaz) (Freeform)<br />
11:00pm – The Christmas Note (2015) (Hallmark Movies)<br />
12:00am – With Love, Christmas (2017) (Hallmark)<br />
12:30am – Planes, Trains, and Automobiles (1987, Steve Martin, John Candy) (AMC)<br />
1:00am – A Bramble House Christmas (2017) (Hallmark Movies)<br />
2:00am – The Christmas Cure (2017, Patrick Duffy) (Hallmark)<br />
2:30am – Ernest Saves Christmas (1988) (AMC)<br />
3:00am – Marrying Father Christmas (2018, Wendie Malick) (Hallmark Movies)<br />
4:00am – Every Christmas Has a Story (2016, Lori Loughlin) (Hallmark)<br />
4:30am – MASH (AMC)<br />
<br />
<b>Monday, December 3</b><br />
7:00am – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
8:30am – Winnie the Pooh and Christmas Too (Freeform)<br />
9:00am – ‘Twas the Night Before Christmas (1974, Rankin/Bass) (AMC)<br />
9:00am – The Little Drummer Boy (1968, Rankin/Bass) (Freeform)<br />
9:30am – The Nativity Story (2006) (AMC)<br />
11:00am – Decorating Disney: Holiday Magic (Freeform)<br />
12:00pm – The Truth About Christmas (Freeform)<br />
1:30pm – Planes, Trains, and Automobiles (1987, Steve Martin, John Candy) (AMC)<br />
2:10pm – The Holiday (2006, Cameron Diaz) (Freeform)<br />
3:30pm – Prancer (1989, Sam Elliott) (AMC)<br />
6:00pm – Jingle All the Way (1996, Arnold Schwarzenegger) (AMC)<br />
7:25pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
8:00pm – The Great Christmas Light Fight (ABC)<br />
8:00pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
9:30pm – Pop Up Santa Holiday Special (Freeform)<br />
10:00pm – The Good Doctor (ABC)<br />
10:00pm – Deal or No Deal: Happy Howie Days (NBC)<br />
10:30pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
12:00am – The Family Stone (2005, Rachel McAdams, Diane Keaton) (Freeform)<br />
1:00am – Gremlins (1984) (AMC)<br />
3:30am – Prancer (1989, Sam Elliott) (AMC)<br />
<br />
<b>Tuesday, December 4</b><br />
Saturday Night Live Christmas Special tonight on NBC!<br />
7:00am – Decorating Disney: Holiday Magic (Freeform)<br />
8:00am – Pop Up Santa Holiday Special (Freeform)<br />
9:00am – To Grandmother’s House We Go (AMC)<br />
11:00am – A Holiday to Remember (1995, Randy Travis) (AMC)<br />
11:30am – Love the Coopers (2015, Ed Helms) (Freeform)<br />
1:00pm – The Sons of Mistletoe (AMC)<br />
2:05pm – The Family Stone (2005, Rachel McAdams, Diane Keaton) (Freeform)<br />
3:00pm – Gremlins (1984) (AMC)<br />
4:10pm – This Christmas (2007, Idris Elba) (Freeform)<br />
6:50pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
8:00pm – The Conners (ABC)<br />
8:00pm – The Polar Express (2004, Tom Hanks) (AMC)<br />
8:55pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
9:00pm – Saturday Night Live Best of Christmas (NBC)<br />
12:00am – Home Alone 3 (1997) (Freeform)<br />
2:30am – The Sons of Mistletoe (AMC)<br />
<br />
<b>Wednesday, December 5</b><br />
7:00am – I’ll Be Home for Christmas (1998, Jonathan Taylor Thomas) (Freeform)<br />
9:00am – 12 Dogs of Christmas: Great Puppy Rescue (2005) (AMC)<br />
9:00am – Mickey’s Christmas Carol (1983) (Freeform)<br />
11:00am – Disney’s Fairy Tale Weddings: Holiday Magic (Freeform)<br />
11:30am – A Dennis the Menace Christmas (2007, Robert Wagner) (AMC)<br />
12:00pm – Home Alone 3 (1997) (Freeform)<br />
1:30pm – All I Want for Christmas (1991, Ethan Embry, Thora Birch) (AMC)<br />
2:00pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
4:05pm – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
5:10pm – The Nightmare Before Christmas (1993) (Freeform)<br />
6:00pm – The Polar Express (2004, Tom Hanks) (AMC)<br />
6:50pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – Elf (2003, Will Ferrell) (AMC)<br />
8:55pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
12:00am – I’ll Be Home for Christmas (1998, Jonathan Taylor Thomas) (Freeform)<br />
2:30am – All I Want for Christmas (1991, Ethan Embry, Thora Birch) (AMC)<br />
4:30am – MASH (AMC)<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-bZfFgj6OC6M/XALJBNhbFnI/AAAAAAACTfQ/Uam6ANRHUyILoVoS095HwXD21_OJyMcsgCLcBGAs/s1600/Grinch_holiday.filminspector.com_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="The Grinch and Max animatedfilmreviews.filminspector.com" border="0" data-original-height="615" data-original-width="401" height="320" itemprop="image" src="https://4.bp.blogspot.com/-bZfFgj6OC6M/XALJBNhbFnI/AAAAAAACTfQ/Uam6ANRHUyILoVoS095HwXD21_OJyMcsgCLcBGAs/s320/Grinch_holiday.filminspector.com_1.jpg" title="" width="208" /></a></div>
<br />
<b>Thursday, December 6 </b><br />
It’s A Wonderful Life on USA at 8pm!<br />
A Charlie Brown Christmas tonight on ABC at 8pm!<br />
The Grinch cartoon & Elf on the Shelf on TBS tonight at 8pm!<br />
5:00am – MASH (AMC)<br />
5:30am – MASH (AMC)<br />
7:00am – Mickey’s Christmas Carol (1983) (Freeform)<br />
7:30am – Santa Paws 2: The Santa Pups (Freeform)<br />
9:00am – Christmas in Connecticut (1945, Barbara Stanwyck) (AMC)<br />
11:00am – Joyful Noise (2012, Queen Latifah, Dolly Parton) (AMC)<br />
12:00pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
1:30pm – Last Holiday (2006, Queen Latifah) (AMC)<br />
2:05pm – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
3:10pm – The Nightmare Before Christmas (1993) (Freeform)<br />
4:50pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
6:00pm – Elf (2003, Will Ferrell) (AMC)<br />
8:00pm – A Charlie Brown Christmas (1965) (ABC)<br />
8:00pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
8:00pm – Dr. Seuss’ How the Grinch Stole Christmas (1966 cartoon) (TBS)<br />
8:00pm – It’s A Wonderful Life (1946, James Stewart, Donna Reed) (USA)<br />
8:30pm – The Elf on the Shelf: An Elf’s Story (2011) (TBS)<br />
9:00pm – The Great American Baking Show: Holiday Edition (ABC)<br />
10:15pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
12:00am – Call Me Claus (Freeform)<br />
12:30am – Last Holiday (2006, Queen Latifah) (AMC)<br />
3:00am – Joyful Noise (2012, Queen Latifah, Dolly Parton) (AMC)<br />
<br />
<b>Friday, December 7</b><br />
A Christmas Story on TBS at 7pm & 9pm!<br />
7:30am – Jingle All the Way 2 (Freeform)<br />
9:00am – The Nativity Story (2006) (AMC)<br />
11:00am – The Little Drummer Boy: Book II (1976, Rankin/Bass) (AMC)<br />
11:00am – Call Me Claus (Freeform)<br />
11:30am – The Story of the First Christmas Snow (1975, Rankin/Bass) (AMC)<br />
12:00pm – The Life and Adventures of Santa Claus (1985, Rankin/Bass) (AMC)<br />
1:10pm – Unaccompanied Minors (2006) (Freeform)<br />
1:15pm – The Leprechauns’ Christmas Gold (1981, Rankin/Bass) (AMC)<br />
1:45pm – Nestor, the Long-Eared Christmas Donkey (1977, Rankin/Bass) (AMC)<br />
2:15pm – Jack Frost (1979, Rankin/Bass) (AMC)<br />
3:30pm – Frosty’s Winter Wonderland (1976, Rankin/Bass) (AMC)<br />
4:00pm – ‘Twas the Night Before Christmas (1974, Rankin/Bass) (AMC)<br />
4:30pm – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
5:45pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
7:00pm – Donkey’s Caroling Christmas-tacular (2010) (AMC)<br />
7:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
7:15pm – The Madagascar Penguins in a Christmas Caper (2005) (AMC)<br />
7:30pm – Merry Madagascar (2009) (AMC)<br />
8:00pm – Mariah Carey’s All I Want for Christmas Is You (2017) (AMC)<br />
8:00pm – Christmas Lost and Found (Lifetime)<br />
9:00pm – The Victoria’s Secret Fashion Show Holiday Special (ABC)<br />
9:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
9:50pm – Disney’s A Christmas Carol (2009, Jim Carrey) (Freeform)<br />
10:00pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
11:15pm – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
11:55pm – A Belle for Christmas (Freeform)<br />
12:30am – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
2:45am – White Christmas (1954, Bing Crosby) (AMC)<br />
<br />
<b>Saturday, December 8 </b><br />
Rudolph & Frosty tonight on CBS!!!<br />
7:00am – The Little Drummer Boy (1968, Rankin/Bass) (Freeform)<br />
7:30am – MASH (AMC)<br />
7:30am – Winnie the Pooh and Christmas Too (Freeform)<br />
8:00am – MASH (AMC)<br />
8:00am – A Belle for Christmas (Freeform)<br />
8:30am – MASH (AMC)<br />
9:00am – Christmas in Connecticut (1945, Barbara Stanwyck) (AMC)<br />
10:00am – Fred Claus (2007, Vince Vaughn) (TBS)<br />
10:10am – Unaccompanied Minors (2006) (Freeform)<br />
11:30am – White Christmas (1954, Bing Crosby) (AMC)<br />
12:00pm – Meet John Doe (1941, Gary Cooper, Barbara Stanwyck) (TCM)<br />
12:15pm – Deck the Halls (2006, Danny DeVito, Matthew Broderick) (Freeform)<br />
2:15pm – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
2:20pm – Disney’s A Christmas Carol (2009, Jim Carrey) (Freeform)<br />
4:25pm – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
4:30pm – The Sons of Mistletoe (AMC)<br />
6:30pm – Jingle All the Way (1996, Arnold Schwarzenegger) (AMC)<br />
8:00pm – The Great American Baking Show: Holiday Edition (ABC)<br />
8:00pm – Rudolph the Red-Nosed Reindeer (1964, Rankin/Bass) (CBS)<br />
8:00pm – Disney’s Fairy Tale Weddings: Holiday Magic (Freeform)<br />
8:00pm – Homegrown Christmas (2018, Lori Loughlin) (Hallmark)<br />
8:00pm – Santa’s Boots (Lifetime)<br />
8:00pm – Holiday Inn (1942, Bing Crosby) (TCM)<br />
8:30pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
9:00pm – Frosty the Snowman (1969, Rankin/Bass) (CBS)<br />
9:00pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
9:00pm – Memories of Christmas (2018, Christina Milian) (Hallmark Movies)<br />
9:30pm – Frosty Returns (1992, Rankin/Bass) (CBS)<br />
10:00pm – Christmas at Pemberley Manor (2018) (Hallmark)<br />
10:00pm – The Man Who Came to Dinner (1941, Bette Davis) (TCM)<br />
11:00pm – The Polar Express (2004, Tom Hanks) (AMC)<br />
11:00pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
1:00am – Disney’s Fairy Tale Weddings: Holiday Magic (Freeform)<br />
3:30am – Gremlins (1984) (AMC)<br />
<br />
<b>Sunday, December 9 </b><br />
6:00am – Rudolph & Frosty’s Christmas in July (1979, Rankin/Bass) (AMC)<br />
7:00am – Winnie the Pooh and Christmas Too (Freeform)<br />
7:30am – Deck the Halls (2006, Danny DeVito, Matthew Broderick) (Freeform)<br />
8:15am – Christmas in Connecticut (1945, Barbara Stanwyck) (TCM)<br />
8:30am – Gremlins (1984) (AMC)<br />
9:30am – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
2:45pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
4:00pm – Jingle All the Way (1996, Arnold Schwarzenegger) (AMC)<br />
4:50pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
5:00pm – Love Actually (2003, Hugh Grant) (TBS)<br />
6:00pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
6:55pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
7:00pm – Christmas with a Prince (UP)<br />
8:00pm – Dancing With the Stars: Juniors (ABC)<br />
8:00pm – Christmas Wonderland (2018, Emily Osment) (Hallmark)<br />
8:00pm – A Christmas in Tennessee (Lifetime)<br />
8:00pm – It Happened on Fifth Avenue (1947) (TCM)<br />
8:30pm – The Polar Express (2004, Tom Hanks) (AMC)<br />
9:00pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
9:00pm – Once Upon a Christmas Miracle (2018) (Hallmark Movies)<br />
9:00pm – A Fairytale Christmas (UP)<br />
11:35pm – Love the Coopers (2015, Ed Helms) (Freeform)<br />
1:30am – Nothing Like the Holidays (John Leguizamo) (AMC)<br />
3:45am – A Holiday to Remember (1995, Randy Travis) (AMC)<br />
<br />
<b>Monday, December 10</b><br />
CMA Country Christmas on ABC tonight!<br />
7:00am – This Christmas (2007, Idris Elba) (Freeform)<br />
11:00am – Disney’s Fairy Tale Weddings: Holiday Magic (Freeform)<br />
12:00pm – Love the Coopers (2015, Ed Helms) (Freeform)<br />
2:00pm – Planes, Trains, and Automobiles (1987, Steve Martin, John Candy) (AMC)<br />
2:35pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
4:40pm – The Nightmare Before Christmas (1993) (Freeform)<br />
6:20pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
7:00pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
8:00pm – CMA Country Christmas (ABC)<br />
9:00pm – No Sleep ‘Til Christmas (Freeform)<br />
9:15pm – National Lampoon’s Christmas Vacation (1989, Chevy Chase) (AMC)<br />
10:00pm – The Great Christmas Light Fight (ABC)<br />
11:30pm – Last Holiday (2006, Queen Latifah) (AMC)<br />
12:00am – Holiday in Handcuffs (2007, Melissa Joan Hart, Mario Lopez) (Freeform)<br />
4:30am – Pinocchio’s Christmas (1980, Rankin/Bass) (AMC)<br />
<br />
<b>Tuesday, December 11</b><br />
7:00am – Winnie the Pooh and Christmas Too (Freeform)<br />
7:30am – Unaccompanied Minors (2006) (Freeform)<br />
9:00am – Joyful Noise (2012, Queen Latifah, Dolly Parton) (AMC)<br />
11:00am – Pop Up Santa Holiday Special (Freeform)<br />
11:30am – Planes, Trains, and Automobiles (1987, Steve Martin, John Candy) (AMC)<br />
12:35pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
1:30pm – Prancer (1989, Sam Elliott) (AMC)<br />
2:40pm – The Nightmare Before Christmas (1993) (Freeform)<br />
4:00pm – Frosty’s Winter Wonderland (1976, Rankin/Bass) (AMC)<br />
4:20pm – Jingle All the Way 2 (Freeform)<br />
4:30pm – Rudolph’s Shiny New Year (1976, Rankin/Bass) (AMC)<br />
5:45pm – The Year Without a Santa Claus (1974, Rankin/Bass) (AMC)<br />
7:00pm – Elf (2003, Will Ferrell) (AMC)<br />
8:31pm – The Kids Are Alright (ABC)<br />
9:00pm – black-ish (ABC)<br />
9:00pm – Darci Lynne: My Hometown Christmas (Pentatonix, Toby Keith) (NBC)<br />
9:00pm – Elf (2003, Will Ferrell) (AMC)<br />
10:00pm – Hollywood Game Night (NBC)<br />
12:00am – Beethoven’s Christmas Adventure (2011, Curtis Armstrong) (Freeform)<br />
1:00am – Joyful Noise (2012, Queen Latifah, Dolly Parton) (AMC)<br />
3:30am – To Grandmother’s House We Go (AMC)<br />
<br />
<b>Wednesday, December 12</b><br />
John Legend Christmas Special tonight on NBC!<br />
7:00am – Beethoven’s Christmas Adventure (2011, Curtis Armstrong) (Freeform)<br />
9:00am – The Little Drummer Boy: Book II (1976, Rankin/Bass) (AMC)<br />
9:30am – Nestor, the Long-Eared Christmas Donkey (1977, Rankin/Bass) (AMC)<br />
10:00am – To Grandmother’s House We Go (AMC)<br />
11:30am – Jingle All the Way 2 (Freeform)<br />
12:00pm – Gremlins (1984) (AMC)<br />
1:30pm – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
3:00pm – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
7:00pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
8:00pm – The Goldbergs (ABC)<br />
8:00pm – Ellen’s Game of Games (NBC)<br />
8:30pm – American Housewife (ABC)<br />
9:00pm – Modern Family (ABC)<br />
9:00pm – Little Big Shots (NBC)<br />
9:00pm – Disney’s A Christmas Carol (2009 Jim Carrey) (Freeform)<br />
9:30pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
9:31pm – Single Parents (ABC)<br />
10:00pm – A Million Little Things (ABC)<br />
10:00pm – A Legendary Christmas with John & Chrissy (NBC)<br />
12:00am – Call Me Claus (Freeform)<br />
2:30am – Gremlins (1984) (AMC)<br />
<br />
<b>Thursday, December 13</b><br />
One Magic Christmas on AMC at 11am!<br />
Disney’s Prep & Landing 1 & 2 on ABC tonight!<br />
Saturday Night Live Christmas Special tonight on NBC!<br />
5:00am – The Leprechauns’ Christmas Gold (1981, Rankin/Bass) (AMC)<br />
7:00am – Call Me Claus (Freeform)<br />
9:00am – Samantha: An American Girl Holiday (AMC)<br />
11:00am – One Magic Christmas (1985, Mary Steenburgen) (AMC)<br />
11:00am – No Sleep ‘Til Christmas (Freeform)<br />
1:00pm – The Christmas Star (1986, Ed Asner) (AMC)<br />
1:05pm – This Christmas (2007, Idris Elba) (Freeform)<br />
3:00pm – A Holiday to Remember (1995, Randy Travis) (AMC)<br />
3:40pm – Holiday in Handcuffs (2007, Melissa Joan Hart, Mario Lopez) (Freeform)<br />
5:00pm – The Sons of Mistletoe (AMC)<br />
5:45pm – The Holiday (2006, Cameron Diaz) (Freeform)<br />
7:00pm – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
8:00pm – Disney’s Prep & Landing (ABC)<br />
8:30pm – Disney’s Prep & Landing 2: Naughty vs. Nice (ABC)<br />
8:55pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
9:00pm – The Great American Baking Show: Holiday Edition (ABC)<br />
9:00pm – Saturday Night Live Best of Christmas (NBC)<br />
9:15pm – Miracle on 34th Street (1947, Natalie Wood) (AMC)<br />
11:30pm – White Christmas (1954, Bing Crosby) (AMC)<br />
12:00am – Deck the Halls (2006, Danny DeVito, Matthew Broderick) (Freeform)<br />
2:15am – White Christmas (1954, Bing Crosby) (AMC)<br />
<br />
<b>Friday, December 14 </b><br />
7:00am – The Family Stone (2005, Rachel McAdams, Diane Keaton) (Freeform)<br />
9:00am – Scoot and Kassie’s Christmas Adventure (AMC)<br />
11:00am – To Grandmother’s House We Go (AMC)<br />
11:00am – Angels Sing (Freeform)<br />
1:00pm – A Dennis the Menace Christmas (2007, Robert Wagner) (AMC)<br />
1:05pm – The Mistle-tones (Freeform)<br />
3:00pm – Ernest Saves Christmas (1988) (AMC)<br />
3:10pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
5:45pm – Deck the Halls (2006, Danny DeVito, Matthew Broderick) (Freeform)<br />
7:00pm – The Polar Express (2004, Tom Hanks) (AMC)<br />
7:20pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
8:00pm – Fresh Off the Boat (ABC)<br />
8:00pm – I Love Lucy Christmas Special (CBS)<br />
8:00pm – The 87th Annual Hollywood Christmas Parade (CW)<br />
8:00pm – Christmas Around the Corner (Lifetime)<br />
8:30pm – Speechless (ABC)<br />
9:00pm – The Santa Clause 2 (2002, Tim Allen) (AMC)<br />
9:25pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
11:30pm – Jingle All the Way (1996, Arnold Schwarzenegger) (AMC)<br />
11:30pm – The Family Stone (2005, Rachel McAdams, Diane Keaton) (Freeform)<br />
<br />
<b>Saturday, December 15 </b><br />
7:00am – Mickey’s Christmas Carol (1983) (Freeform)<br />
7:30am – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
9:00am – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
10:30am – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
12:00pm – Holiday Affair (1949, Robert Mitchum) (TCM)<br />
12:35pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – The Great Christmas Light Fight (ABC)<br />
8:00pm – A Gingerbread Romance (2018, Tia Mowry-Hardrict) (Hallmark)<br />
8:00pm – Christmas Pen Pals (Lifetime)<br />
8:00pm – Trail of Robin Hood (TCM)<br />
9:00pm – Time for Me to Come Home for Christmas (2018) (Hallmark Movies)<br />
9:15pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
9:30pm – Three Godfathers (1948, John Wayne) (TCM)<br />
11:30pm – Star in the Night (TCM)<br />
<br />
<b>Sunday, December 16 </b><br />
The Sound of Music on ABC tonight!<br />
6:00am – The Shop Around the Corner (1940, James Stewart) (TCM)<br />
7:00am – A Belle for Christmas (Freeform)<br />
8:00am – In the Good Old Summertime (1949, Judy Garland) (TCM)<br />
9:00am – Jingle All the Way 2 (Freeform)<br />
11:00am – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
6:35pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
7:00pm – The Sound of Music (1965, Julie Andrews) (ABC)<br />
7:00pm – Christmas on Holly Lane (UP)<br />
8:00pm – Entertaining Christmas (2018, Jodie Sweetin) (Hallmark)<br />
8:00pm – Hometown Christmas (Lifetime)<br />
8:00pm – Meet Me in St. Louis (1944, Judy Garland) (TCM)<br />
9:00pm – Reunited at Christmas (2018, Nikki Deloach) (Hallmark Movies)<br />
9:15pm – Disney’s A Christmas Carol (2009 Jim Carrey) (Freeform)<br />
11:20pm – A Miracle on Christmas Lake (Freeform)<br />
<br />
<b>Monday, December 17 </b><br />
7:00am – Beethoven’s Christmas Adventure (2011, Curtis Armstrong) (Freeform)<br />
9:00am – Angels Sing (Freeform)<br />
11:00am – Call Me Claus (Freeform)<br />
1:00pm – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
3:05pm – Deck the Halls (2006, Danny DeVito, Matthew Broderick) (Freeform)<br />
5:10pm – Disney’s A Christmas Carol (2009 Jim Carrey) (Freeform)<br />
7:15pm – The Nightmare Before Christmas (1993) (Freeform)<br />
8:00pm – The Great Christmas Light Fight (ABC)<br />
8:00pm – Lady on a Train (TCM)<br />
10:00pm – America’s Got Talent (NBC)<br />
10:00pm – Lady in the Lake (TCM)<br />
12:00am – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
12:00am – Fitzwilly (1967, Dick Van Dyke) (TCM)<br />
2:00am – Crooks Anonymous (TCM)<br />
3:45am – Cover-Up (TCM)<br />
<br />
<b>Tuesday, December 18</b><br />
7:00am – The Little Drummer Boy (1968, Rankin/Bass) (Freeform)<br />
7:30am – Mickey’s Christmas Carol (1983) (Freeform)<br />
8:00am – Call Me Claus (Freeform)<br />
10:00am – The Nightmare Before Christmas (1993) (Freeform)<br />
1:35pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
3:40pm – The Truth About Christmas (Freeform)<br />
5:45pm – The Holiday (2006, Cameron Diaz) (Freeform)<br />
8:55pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
12:00am – 12 Dates of Christmas (Freeform)<br />
<br />
<b>Wednesday, December 19 </b><br />
Olaf’s Frozen Adventure & Shrek the Halls on ABC tonight!<br />
Grandma Got Run Over by a Reindeer tonight on CW!<br />
7:00am – Snow (Freeform)<br />
9:00am – Snow 2: Brain Freeze (Freeform)<br />
11:00am – The Family Stone (2005, Rachel McAdams, Diane Keaton) (Freeform)<br />
1:00pm – Disney’s Fairy Tale Weddings: Holiday Magic (Freeform)<br />
2:00pm – The Holiday (2006, Cameron Diaz) (Freeform)<br />
5:05pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
7:10pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – Olaf’s Frozen Adventure (ABC)<br />
8:00pm – Grandma Got Run Over by a Reindeer (2000) (CW)<br />
8:00pm – Lego Jurassic World: The Secret Exhibit Parts 1 & 2 (not Christmas) (NBC)<br />
8:00pm – Bachelor Mother (1939, Ginger Rogers) (TCM)<br />
8:30pm – Shrek the Halls (2007) (ABC)<br />
9:00pm – Hollywood Game Night (NBC)<br />
12:00am – All Mine to Give (1957) (TCM)<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/--Y9Dn8lysQM/XALKbNuz3oI/AAAAAAACTfo/al-0OICB6uEaZNniKCBty-DlLw4MBRo_QCLcBGAs/s1600/Charlie_Brown_Christmas_tree_coloring.filminspector.com_10.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Charlie Brown animatedfilmreviews.filminspector.com" border="0" data-original-height="200" data-original-width="200" itemprop="image" src="https://3.bp.blogspot.com/--Y9Dn8lysQM/XALKbNuz3oI/AAAAAAACTfo/al-0OICB6uEaZNniKCBty-DlLw4MBRo_QCLcBGAs/s1600/Charlie_Brown_Christmas_tree_coloring.filminspector.com_10.jpg" title="" /></a></div>
<br />
<b>Thursday, December 20</b><br />
A Charlie Brown Christmas tonight on ABC!<br />
7:00am – Pop Up Santa Holiday Special (Freeform)<br />
8:30am – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
10:00am – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
3:30pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
5:35pm – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
8:00pm – A Charlie Brown Christmas (1965) (ABC)<br />
8:00pm – Timeless (NBC)<br />
9:00pm – The Great American Baking Show: Holiday Edition (ABC)<br />
10:00pm – Ellen’s Game of Games (NBC)<br />
1:30am – Mickey’s Christmas Carol (1983) (Freeform)<br />
<br />
<b>Friday, December 21 </b><br />
I Want a Dog for Christmas, Charlie Brown on ABC tonight!<br />
7:00am – Mickey’s Once Upon a Christmas (1999) (Freeform)<br />
8:30am – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
10:00am – The Doc McStuffins Christmas Special (Freeform)<br />
10:30am – Winnie the Pooh and Christmas Too (Freeform)<br />
11:00am – Mickey’s Christmas Carol (1983) (Freeform)<br />
11:30am – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
12:30pm – Love the Coopers (2015, Ed Helms) (Freeform)<br />
5:05pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
7:10pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – I Want a Dog for Christmas, Charlie Brown (2003) (ABC)<br />
8:00pm – A Home for the Holidays: The 20th Anniversary (CBS)<br />
8:00pm – America’s Got Talent (NBC)<br />
8:00pm – A Christmas Kiss (Lifetime)<br />
8:00pm – Love Actually (2003, Hugh Grant) (TBS)<br />
9:00pm – The Great Christmas Light Fight (ABC)<br />
9:15pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
11:55pm – No Sleep ‘Til Christmas (Freeform)<br />
<br />
<b>Saturday, December 22 </b><br />
CMA Country Christmas on ABC tonight!<br />
7:00am – A Miracle on Christmas Lake (Freeform)<br />
9:40am – The Santa Clause (1994, Tim Allen) (Freeform)<br />
10:00am – Love Actually (2003, Hugh Grant) (TBS)<br />
11:50am – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
1:55pm – Disney/Pixar’s Toy Story That Time Forgot (Tim Allen, Tom Hanks) (Freeform)<br />
2:25pm – Disney’s Prep & Landing (Freeform)<br />
2:55pm – Disney’s Prep & Landing 2: Naughty vs. Nice (Freeform)<br />
3:25pm – The Nightmare Before Christmas (1993) (Freeform)<br />
5:05pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
7:45pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
8:00pm – CMA Country Christmas (ABC)<br />
8:00pm – Christmas Copy (2018) (Hallmark)<br />
8:00pm – A Golden Christmas (Lifetime)<br />
8:00pm – Remember the Night (1940, Fred MacMurray, Barbara Stanwyck) (TCM)<br />
9:00pm – Small Town Christmas (2018) (Hallmark Movies)<br />
9:50pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
10:00pm – Christmas in Connecticut (1945, Barbara Stanwyck) (TCM)<br />
11:55pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
3:45am – Carol for Another Christmas (1964, Rod Serling) (TCM)<br />
<br />
<b>Sunday, December 23</b><br />
Disney’s Prep & Landing 1 & 2 on ABC tonight!<br />
6:00am – Scrooge (1935, Seymour Hicks) (TCM)<br />
7:00am – The Little Drummer Boy (1968, Rankin/Bass) (Freeform)<br />
7:30am – Beethoven’s Christmas Adventure (2011, Curtis Armstrong) (Freeform)<br />
7:30am – TCM Night at the Movies: Merry Christmas! (TCM)<br />
8:30am – Bush Christmas (1947) (TCM)<br />
9:40am – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
11:45pm – Disney/Pixar’s Toy Story That Time Forgot (Tim Allen, Tom Hanks) (Freeform)<br />
12:15pm – Santa Claus Is Comin’ to Town (1970, Rankin/Bass) (Freeform)<br />
1:20pm – The Nightmare Before Christmas (1993) (Freeform)<br />
2:00pm – Susan Slept Here (1954, Debbie Reynolds) (TCM)<br />
3:00pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
4:00pm – All Mine to Give (1957) (TCM)<br />
5:05pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
7:00pm – Hometown Holiday (UP)<br />
7:10pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – Disney’s Prep & Landing (2009) (ABC)<br />
8:00pm – Christmas Made to Order (2018, Alexa PenaVega) (Hallmark)<br />
8:00pm – 3 Holiday Tails (Lifetime)<br />
8:00pm – The Holly and the Ivy (TCM)<br />
8:30pm – Disney’s Prep & Landing 2: Naughty vs. Nice (2011) (ABC)<br />
9:00pm – Christmas Bells are Ringing (2018) (Hallmark Movies)<br />
9:15pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
2:45am – Fanny and Alexander (1982) (TCM)<br />
<br />
<b>Monday, December 24 </b><br />
Christmas Eve<br />
6:00am – Beyond Tomorrow (1940, Harry Carey) (TCM)<br />
7:30am – Richie Rich’s Christmas Wish (1998, Eugene Levy, Martin Mull) (Freeform)<br />
7:30am – Little Women (1933, Katharine Hepburn) (TCM)<br />
9:30am – The Great Rupert (1950, Jimmy Durante) (TCM)<br />
11:00am – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
12:30pm – The Nightmare Before Christmas (1993) (Freeform)<br />
12:30pm – The Shop Around the Corner (1940, James Stewart) (TCM)<br />
2:05pm – Jingle All the Way 2 (Freeform)<br />
2:15pm – Holiday Affair (1949, Robert Mitchum) (TCM)<br />
4:00pm – Christmas in Connecticut (1945, Barbara Stanwyck) (TCM)<br />
4:10pm – Disney’s A Christmas Carol (2009 Jim Carrey) (Freeform)<br />
6:00pm – Meet Me in St. Lous (1944, Judy Garland) (TCM)<br />
6:15pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (Freeform)<br />
8:00pm – It’s a Wonderful Life (1946, James Stewart, Donna Reed) (NBC)<br />
8:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
8:00pm – The Bishop’s Wife (1947, Cary Grant) (TCM)<br />
8:55pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
10:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
10:00pm – A Christmas Carol (1938, Reginald Owen) (TCM)<br />
11:30pm – Christmas Eve Mass from St. Peter’s Basilica (NBC)<br />
11:30pm – In the Good Old Summertime (1949, Judy Garland) (TCM)<br />
12:00am – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
12:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
1:30am – Meet John Doe (1941, Gary Cooper, Barbara Stanwyck) (TCM)<br />
2:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
4:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-3qiziDl1jDM/XALKKtQYeJI/AAAAAAACTfc/_1IeVBNNhBc-7h1QG2-SGoiuVIc9QuUkwCLcBGAs/s1600/Grinch_coloring_pages_coloring.filminspector.com_47.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="The Grinch animatedfilmreviews.filminspector.com" border="0" data-original-height="692" data-original-width="500" height="320" itemprop="image" src="https://3.bp.blogspot.com/-3qiziDl1jDM/XALKKtQYeJI/AAAAAAACTfc/_1IeVBNNhBc-7h1QG2-SGoiuVIc9QuUkwCLcBGAs/s320/Grinch_coloring_pages_coloring.filminspector.com_47.gif" title="" width="231" /></a></div>
<br />
<b>Tuesday, December 25 </b><br />
Merry Christmas!<br />
6:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
6:00am – Love Finds Andy Hardy (1938, Mickey Rooney, Judy Garland) (TCM)<br />
7:00am – Disney’s Prep & Landing (2009) (Freeform)<br />
7:30am – Disney’s Prep & Landing 2: Naughty vs. Nice (2011) (Freeform)<br />
8:00am – Mickey’s Twice Upon a Christmas (2004) (Freeform)<br />
8:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
8:00am – Three Godfathers (1948, John Wayne) (TCM)<br />
10:00am – Disney Parks Magical Christmas Day Parade (9am central/mountain/pacific) (ABC)<br />
10:00am – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
10:00am – Bundle of Joy (1956, Eddie Fisher, Debbie Reynolds) (TCM)<br />
11:00am – The Nightmare Before Christmas (1993) (Freeform)<br />
12:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
12:00pm – Bachelor Mother (1939, Ginger Rogers) (TCM)<br />
12:40pm – Disney’s A Christmas Carol (2009 Jim Carrey) (Freeform)<br />
1:30pm – Fitzwilly (1967, Dick Van Dyke) (TCM)<br />
2:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
2:40pm – Christmas With the Kranks (2004, Tim Allen, Jamie Lee Curtis) (Freeform)<br />
3:30pm – The Man Who Came to Dinner (1941, Bette Davis) (TCM)<br />
4:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
4:45pm – The Santa Clause (1994, Tim Allen) (Freeform)<br />
5:45pm – It Happened on Fifth Avenue (1947) (TCM)<br />
6:00pm – A Christmas Story (1983, Peter Billingsley) (TBS)<br />
6:50pm – The Santa Clause 3: The Escape Clause (2006, Tim Allen, Martin Short) (Freeform)<br />
8:00pm – Dr. Seuss’ How the Grinch Stole Christmas (1966 cartoon) (NBC)<br />
8:00pm – When Calls the Heart Christmas (2018, Lori Loughlin, Jack Wagner) (Hallmark)<br />
8:30pm – Dr. Seuss’ How the Grinch Stole Christmas (2000, Jim Carrey) (NBC)<br />
<br />
<b>Wednesday, December 26</b><br />
<br />
<b>Thursday, December 27 </b><br />
11:00am – Susan Slept Here (1954, Debbie Reynolds) (TCM)<br />
<br />
Friday, December 28<br />
<br />
<b>Saturday, December 29 </b><br />
8:00pm – Focus on Love (2018, Carlos PenaVega) (Hallmark)<br />
<br />
Sunday, December 30<br />
<br />
<b>Monday, December 31</b><br />
8:00pm – NBC News Special: A Toast to 2018! (NBC)<br />
10:00pm – NBC’s New Year’s Eve (NBC)<br />
<br />
<b>Tuesday, January 1</b><br />
11:30am – 130th Annual Tournament of Roses Parade (live, 8:30am Pacific) (NBC)<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-ozkcp1n5-2k/XALKRPI8MFI/AAAAAAACTfg/Bw0wxYokODEv9wEMXcxgRF8zHG73Xcv3ACLcBGAs/s1600/Grinch_coloring_pages_coloring.filminspector.com_27.png" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="The Grinch animatedfilmreviews.filminspector.com" border="0" data-original-height="300" data-original-width="300" itemprop="image" src="https://2.bp.blogspot.com/-ozkcp1n5-2k/XALKRPI8MFI/AAAAAAACTfg/Bw0wxYokODEv9wEMXcxgRF8zHG73Xcv3ACLcBGAs/s1600/Grinch_coloring_pages_coloring.filminspector.com_27.png" title="" /></a></div>
<br />
<span class="updated">2020</span></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-79962096946441169742018-11-28T08:32:00.004-07:002020-03-09T00:04:57.972-06:00Ralph Breaks the Internet (2018) - Ralph Meets the Princesses!<div itemscope="" itemtype="https://schema.org/Movie">
<h1>
Ralph and the Princesses!</h1>
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://2.bp.blogspot.com/-KoT_uqwwd_o/W_55VAUlUhI/AAAAAAACTPY/oJ4ddplmACwcOj9yL_f42jniAYDoyq70QCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_1.jpg" style="margin-left: auto; margin-right: auto;"><img alt="Ralph Breaks the Internet coloring pages animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-KoT_uqwwd_o/W_55VAUlUhI/AAAAAAACTPY/oJ4ddplmACwcOj9yL_f42jniAYDoyq70QCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_1.jpg" title="" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Ralph of "Ralph Breaks the Internet" (All photos courtesy Walt Disney Pictures).</td></tr>
</tbody></table>
"<b itemprop="name">Ralph Breaks the Internet</b>" (<span itemprop="dateCreated">2018</span>) is the <span itemprop="productionCompany">Walt Disney Pictures</span> sequel to "Wreck-It Ralph" (2012). It was directed by <span itemprop="director" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Rich Moore</span></span>, who directed "Wreck-It Ralph," and screenwriter <span itemprop="author" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Phil Johnston</span></span>.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-_rjQfEH3eKY/W_55g5uSqXI/AAAAAAACTRQ/Sp0X6T_IEMUtewjVRe7-9jObHSVobPJBwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_36.jpg" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="352" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-_rjQfEH3eKY/W_55g5uSqXI/AAAAAAACTRQ/Sp0X6T_IEMUtewjVRe7-9jObHSVobPJBwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_36.jpg" /></a></div>
<br />
"Ralph Breaks the Internet" is the 57th feature-length <span itemprop="genre">animated feature film</span> by Walt Disney Animation Studios. "Ralph Breaks the Internet," with its explosion of colors and endearing characters, upholds Walt's heartwarming legacy in fine fashion despite a fairly silly plot and more gimmicks than your typical Disney animated feature film.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://1.bp.blogspot.com/-9_GkBRFGqMA/Xkx2DOv8NFI/AAAAAAACfG0/8gMoLZw7jjU7dppi3ipnKoC9oRK4Lf_BwCLcBGAsYHQ/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_1.gif" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Ralph Breaks the Internet coloring pages animatedfilmreviews.filminspector.com" border="0" data-original-height="258" data-original-width="498" itemprop="image" src="https://1.bp.blogspot.com/-9_GkBRFGqMA/Xkx2DOv8NFI/AAAAAAACfG0/8gMoLZw7jjU7dppi3ipnKoC9oRK4Lf_BwCLcBGAsYHQ/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_1.gif" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">The Disney princesses show up!</td></tr>
</tbody></table>
"Ralph Breaks the Internet" features <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">John C. Reilly</span></span> as Wreck-It Ralph, a video game character for fictional arcade game "Fix-It Felix Jr." Reilly played the character in "Wreck-It Ralph." If you've seen "Wreck-It Ralph," you'll know that Ralph is a big, loveable character. Oh, and the Disney princesses are present, too!<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-axCmpZF4BEU/W_55YYdOk0I/AAAAAAACTQI/OKdI0-vuilIpUwUuLDuEC-WFgu8ghCV3wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_2.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="480" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-axCmpZF4BEU/W_55YYdOk0I/AAAAAAACTQI/OKdI0-vuilIpUwUuLDuEC-WFgu8ghCV3wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_2.jpg" /></a></div>
<br />
Ralph is friends with Vanellope von Schweetz, voiced by comedian <span itemprop="actor" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Sarah Silverman</span></span>. Vanellope is another video game character in a fictional video game "Sugar Rush."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-FS1wDPeXluU/XmXPLK4nTYI/AAAAAAACgVo/9q_KUbkYEWctINLOHKlzrfWBpU9G7wUHQCLcBGAsYHQ/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_6.webp" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="209" data-original-width="500" height="266" itemprop="image" src="https://1.bp.blogspot.com/-FS1wDPeXluU/XmXPLK4nTYI/AAAAAAACgVo/9q_KUbkYEWctINLOHKlzrfWBpU9G7wUHQCLcBGAsYHQ/s640/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_6.webp" width="640" /></a></div>
<br />
Vanellope also is voiced by the same actor who voiced her in "Wreck-It Ralph." In fact, most of the actors from "Wreck-It Ralph" return, with new voice actors playing mostly minor characters.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
</div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-Ic-lpLnLdlI/W_55gIlbk8I/AAAAAAACTRI/pIfGpHRi-JoR7VQf4iK7856L-qDaPE3_wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_34.jpg" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="341" data-original-width="640" itemprop="image" src="https://1.bp.blogspot.com/-Ic-lpLnLdlI/W_55gIlbk8I/AAAAAAACTRI/pIfGpHRi-JoR7VQf4iK7856L-qDaPE3_wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_34.jpg" /></a></div>
<br />
Other major characters in "Ralph Breaks the Internet" are Shank (Gal Gadot), Yesss (Taraji P. Henson), Sergeant Tamora Jean Calhoun (Jane Lynch), Fix-It Felix Jr. (Jack McBrayer), J.P. Sampley (Bill Hader), Double Dan (Alfred Molina), KnowsMore (Alan Tudyk), and Mr. Litwak (Ed O'Neill). Alan Tudyk voiced King Candy, the ruler of Sugar Rush, in "Wreck-It Ralph."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-2Gyjbm7pAIg/W_55dk0so7I/AAAAAAACTQ0/heVFIc95glokx5N43my3HYgPQquDxU5JACLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_3.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="360" data-original-width="640" itemprop="image" src="https://4.bp.blogspot.com/-2Gyjbm7pAIg/W_55dk0so7I/AAAAAAACTQ0/heVFIc95glokx5N43my3HYgPQquDxU5JACLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_3.jpg" /></a></div>
<br />
Walt Disney Animation Studios does not do a lot of sequels to its feature-length animation films. Two that stand out were "Winnie the Pooh" (2011), which was a sequel to "The Many Adventures of Winnie the Pooh" (1977), and "The Rescuers Down Under" (1990), which was a sequel to "The Rescuers" (1977). None of the Disney films during the Disney Renaissance of the 1990s had a full-length sequel that was released theatrically.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
</div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-KDAg5fCZ5RE/W_55eBub-YI/AAAAAAACTQ4/P8rrGHaHXew_uxwLZNKq42ahL2RW7Ks4QCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_30.jpg" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="347" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-KDAg5fCZ5RE/W_55eBub-YI/AAAAAAACTQ4/P8rrGHaHXew_uxwLZNKq42ahL2RW7Ks4QCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_30.jpg" /></a></div>
<br />
Walt Disney Animation Studios does a lot of sequels to its animated films, and you probably have seen them in the store. However, they are usually not released theatrically or are not feature-length.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-OAWq80FiI90/XmXO_7N84AI/AAAAAAACgV0/JOkvfcs_PWw9EnAaQ398XRGSP3Q2zp7xwCEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_3.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="207" data-original-width="498" itemprop="image" src="https://1.bp.blogspot.com/-OAWq80FiI90/XmXO_7N84AI/AAAAAAACgV0/JOkvfcs_PWw9EnAaQ398XRGSP3Q2zp7xwCEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_3.gif" /></a></div>
<br />
For instance, "The Little Mermaid" had sequels, but they were released straight-to-video. That doesn't mean they were bad movies, they just didn't fit into Disney's tight schedule for releasing films into theaters. That's a nice problem to have!<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-OMnV_6mktQY/W_55iXEoOuI/AAAAAAACTRc/8-DwOXtVx7EsN5e8_IOhpVfaPNVZaETCgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_4.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="480" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-OMnV_6mktQY/W_55iXEoOuI/AAAAAAACTRc/8-DwOXtVx7EsN5e8_IOhpVfaPNVZaETCgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_4.jpg" /></a></div>
<br />
The next Walt Disney Animation Studios feature-length theatrical sequel is expected to be "Frozen 2" in 2019. "Frozen," of course, was the highest-grossing animation film of all time, so that sequel is eagerly awaited.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-gcmJ2Vk_tu8/XmXPSsL59bI/AAAAAAACgV4/odP1JHgOruUnZWxWhabmymcBi-n4xtZhACEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_4.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="335" data-original-width="800" itemprop="image" src="https://1.bp.blogspot.com/-gcmJ2Vk_tu8/XmXPSsL59bI/AAAAAAACgV4/odP1JHgOruUnZWxWhabmymcBi-n4xtZhACEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_4.gif" /></a></div>
<br />
Elsa and Anna from "Frozen" haven't officially been inducted into the Disney Princess line yet because their films are too popular. You can rest assured, however, that Anna and Elsa will become official princesses when the time is right.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
</div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-0yYaGuyAcek/W_55kbHKpxI/AAAAAAACTRs/kkUO6SXggCMtOlqECNSCpTy64ueuzhD8wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_7.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="298" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-0yYaGuyAcek/W_55kbHKpxI/AAAAAAACTRs/kkUO6SXggCMtOlqECNSCpTy64ueuzhD8wCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_7.jpg" /></a></div>
<br />
The general plot of "Ralph Breaks the Internet" is that Wreck-It Ralph and Vanellope von Schweetz like to play a video game together at Litwak's Family Fun Center and Arcade, but they accidentally break the game's wheel. The wheel is so expensive that Mr. Litwak shuts the game down rather than repair it. Wreck-It Ralph and Vanellope find a replacement wheel, but it is too expensive. So, they steal a car from the online game "Slaughter Race" to raise the money.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-g0z_41TuODg/W_6vJGFlZpI/AAAAAAACTV4/cgo21h7QrjAWl3VvV0V--q8eWgvc4NlegCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_62.gif" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages animatedfilmreviews.filminspector.com" border="0" data-original-height="270" data-original-width="480" itemprop="image" src="https://4.bp.blogspot.com/-g0z_41TuODg/W_6vJGFlZpI/AAAAAAACTV4/cgo21h7QrjAWl3VvV0V--q8eWgvc4NlegCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_62.gif" /></a></div>
<br />
When this doesn't work, they create a series of popular videos that become viral. Eventually, Ralph earns the money to pay for the wheel, but Vanellope decides that she wants to leave the arcade and go into Slaughter Race permanently. Ralph unleashes a virus into Slaughter Race" to get Vanellope's mind off of it, but the virus accidentally clones Ralph on the Internet. Ultimately, the Disney Princesses come to the rescue and save Ralph from the clones, while Vanellope stays in Slaughter Race.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-vNy5yAADMvE/W_55jSKcNcI/AAAAAAACTRk/Gju9IsZehm8-RkI33k-HeQNKcM5x8BUHgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_5.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="335" data-original-width="640" itemprop="image" src="https://1.bp.blogspot.com/-vNy5yAADMvE/W_55jSKcNcI/AAAAAAACTRk/Gju9IsZehm8-RkI33k-HeQNKcM5x8BUHgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_5.jpg" /></a></div>
<br />
A lot of popular video game and movie characters appear in "Ralph Breaks the Internet." In fact, this is the first time that many of these characters appear outside of their own games.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-mjO3LfrnYQ8/W_55cTF6VtI/AAAAAAACTQo/PZiX2kEOUocOPf6X-eeX4nhgnGJ_8MRgQCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_28.jpg" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="360" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-mjO3LfrnYQ8/W_55cTF6VtI/AAAAAAACTQo/PZiX2kEOUocOPf6X-eeX4nhgnGJ_8MRgQCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_28.jpg" /></a></div>
<br />
For instance, Sonic the Hedgehog, Buzz Lightyear, and C-3PO from "Star Wars" appear in "Ralph Breaks the Internet." There also are a lot of new characters from Slaughter Race, such as Pyro (Hamish Blake), Felony (Ali Wong), and Little Debby (GloZell Green).<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-QnOoqZlnB9Q/W_6udMpR-mI/AAAAAAACTVw/uS0MtmgHuz0l-_yjKU0aI56d4OFz776CwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_58.gif" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Ralph Breaks the Internet coloring pages animatedfilmreviews.filminspector.com" border="0" data-original-height="280" data-original-width="540" itemprop="image" src="https://4.bp.blogspot.com/-QnOoqZlnB9Q/W_6udMpR-mI/AAAAAAACTVw/uS0MtmgHuz0l-_yjKU0aI56d4OFz776CwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_58.gif" /></a></div>
<br />
By far, though, the most popular guest stars in "Ralph Breaks the Internet" are the princesses from other Walt Disney films. The princesses who appear in "Ralph Breaks the Internet" include: Jennifer Hale as Cinderella, Kate Higgins as Aurora, Jodi Benson as Ariel, Paige O'Hara as Belle, Linda Larkin as Jasmine, Irene Bedard as Pocahontas, Ming-Na Wen as Mulan, Anika Noni Rose as Tiana, Mandy Moore as Rapunzel, and Kelly Macdonald as Merida.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-3_1x2FgDegc/W_55lW73GnI/AAAAAAACTR0/UjPh4XkXptoA9cuMLlPfUI6EOAip-aSvgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_9.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="640" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-3_1x2FgDegc/W_55lW73GnI/AAAAAAACTR0/UjPh4XkXptoA9cuMLlPfUI6EOAip-aSvgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_9.jpg" /></a></div>
<br />
The voice actors who voice the princesses are the same ones that voice the characters in their most recent films. Snow White also appears, voiced by screenwriter Pamela Ribon. Most people who watch "Ralph Breaks the Internet" are most fascinated by the appearance of the Disney princesses.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-B0xK5diBvzs/W_55VY3pRxI/AAAAAAACTPc/6NthjnhNY7EBKzg03OMWkgGla-pooAuVACLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_11.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="640" data-original-width="640" height="640" itemprop="image" src="https://2.bp.blogspot.com/-B0xK5diBvzs/W_55VY3pRxI/AAAAAAACTPc/6NthjnhNY7EBKzg03OMWkgGla-pooAuVACLcBGAs/s640/Ralph_Breaks_Internet_coloring.filminspector.com_11.jpg" width="640" /></a></div>
<br />
A lot of other Disney characters favorites appear in "Ralph Breaks the Internet." These other Disney characters who appear in "Ralph Breaks the Internet" include Mickey Mouse, Grumpy, Dumbo, Humphrey the Bear, Eeyore, Tinker Bell, Nick Wilde, Heihei, Baymax, R2-D2, Yoda, First Order Stormtroopers, Iron Man, Judy Hopps, and Rocket Raccoon. If you know who all those characters are without having to look them up, you watch a lot of Disney animated films!<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-MJXmZkyFWzg/W_55WECzDOI/AAAAAAACTPo/9byKvNe4L9IYrANdXaC2XjJQ8-XJFV5KgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_13.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="361" data-original-width="640" itemprop="image" src="https://2.bp.blogspot.com/-MJXmZkyFWzg/W_55WECzDOI/AAAAAAACTPo/9byKvNe4L9IYrANdXaC2XjJQ8-XJFV5KgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_13.jpg" /></a></div>
<br />
A big rumor was that Mario from the Mario Brothers would appear. However, Mario is not in "Ralph Breaks the Internet." There are more rumors that, if there is a third "Wreck-It Ralph" film, Mario will star in it. However, nothing along those lines has been said officially and probably won't for several years.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-Mx8JHraF7vQ/W_55Wyr0O4I/AAAAAAACTPw/VvZx3oC0pj0LAHH9PBij7Kw8k82W7QSHgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_15.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="400" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-Mx8JHraF7vQ/W_55Wyr0O4I/AAAAAAACTPw/VvZx3oC0pj0LAHH9PBij7Kw8k82W7QSHgCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_15.jpg" /></a></div>
<br />
<span itemprop="musicby" itemscope="" itemtype="https://schema.org/Person"><span itemprop="name">Alan Menken</span></span> wrote an original song for "Ralph Breaks the Internet," "A Place Called Slaughter Race." Menken has written music for many Disney films, including some of the most popular such as "The Little Mermaid" (1989). Disney released "Ralph Breaks the Internet" in the United States on 21 November 2018. The release date in the United Kingdom is 30 November 2018.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-NVYnpypTVjY/W_55XQStIMI/AAAAAAACTP4/9VCC7oiTeJEmx6VEMeTv9FdIApLmughewCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_17.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="426" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-NVYnpypTVjY/W_55XQStIMI/AAAAAAACTP4/9VCC7oiTeJEmx6VEMeTv9FdIApLmughewCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_17.jpg" /></a></div>
<br />
"Ralph Breaks the Internet" finished first at the box office in the United States during its opening weekend. This was the second-best Thanksgiving opening ever for Disney, only behind "Frozen." "Ralph Breaks the Internet" did slightly worse than expectations, though.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-JICEu42dRgs/W_55Xwsg1CI/AAAAAAACTQA/W2dbFsRFBz0Inkbs0rGBLD8JTR76M6_RwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_19.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="324" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-JICEu42dRgs/W_55Xwsg1CI/AAAAAAACTQA/W2dbFsRFBz0Inkbs0rGBLD8JTR76M6_RwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_19.jpg" /></a></div>
<br />
The animators put a lot of work into "Ralph Breaks the Internet." There are 150 unique sets in "Ralph Breaks the Internet." That requires a lot of work in creating an entire environment in which the characters can move around and with which they interact. That's probably one of the reasons why it took six years to release this sequel to "Wreck-It Ralph."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-6rHFbUaCIts/W_55ZWo20NI/AAAAAAACTQQ/8XSYvQ4qnfA89kOe1qW2LqM3RaGb-QUHQCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_21.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="360" data-original-width="640" itemprop="image" src="https://3.bp.blogspot.com/-6rHFbUaCIts/W_55ZWo20NI/AAAAAAACTQQ/8XSYvQ4qnfA89kOe1qW2LqM3RaGb-QUHQCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_21.jpg" /></a></div>
<br />
The credits for "Ralph Breaks the Internet" feature Ralph "rickrolling" the audience. If you don't know what that means, watch the film.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-C-uTnvyEWXg/W_55ad-V2kI/AAAAAAACTQY/mrS2jUrMSwMYh9xPn6nbzwzVqU4_bHbMACLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_23.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="360" itemprop="image" src="https://4.bp.blogspot.com/-C-uTnvyEWXg/W_55ad-V2kI/AAAAAAACTQY/mrS2jUrMSwMYh9xPn6nbzwzVqU4_bHbMACLcBGAs/s640/Ralph_Breaks_Internet_coloring.filminspector.com_23.jpg" width="640" /></a></div>
<br />
Some of the Disney Princesses haven't been seen in an animated film in a long time. In fact, the animators had difficulty creating some of the princesses because they had never been portrayed in modern animation. The animators had to translate the original hand-drawn characters into three-dimensional characters. To do this, they used some dolls of the characters. Thus, even though all of the Disney princesses appeared in their own films, some have a very new look in "Ralph Breaks the Internet."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-lrZ4OAshJ3Y/W_55bb0ZtYI/AAAAAAACTQg/fiB4QsGUol41kVD2XNiPwbox6QzQ1TxfwCLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_25.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="480" data-original-width="640" height="480" itemprop="image" src="https://4.bp.blogspot.com/-lrZ4OAshJ3Y/W_55bb0ZtYI/AAAAAAACTQg/fiB4QsGUol41kVD2XNiPwbox6QzQ1TxfwCLcBGAs/s640/Ralph_Breaks_Internet_coloring.filminspector.com_25.jpg" width="640" /></a></div>
<br />
There are lots of very current references in "Ralph Breaks the Internet." For instance, certain websites are key parts of the plot of "Ralph Breaks the Internet." Among the sites mentioned in "Ralph Breaks the Internet" are eBay and YouTube, thought YouTube is called "BuzzTube."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-gazXtJJs6VY/XmXPNTNDVAI/AAAAAAACgV8/OWd21MVaLdcx5QsRGQgSK3KHBhgZJPM-gCEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_5.webp" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="254" data-original-width="500" itemprop="image" src="https://1.bp.blogspot.com/-gazXtJJs6VY/XmXPNTNDVAI/AAAAAAACgV8/OWd21MVaLdcx5QsRGQgSK3KHBhgZJPM-gCEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_5.webp" /></a></div>
<br />
There also is a lot of talk about routers and viruses and so on and so forth. If you aren't that into the Internet, it may get a bit confusing at times. However, if you are a computer geek, or just really like the Disney princesses, "Ralph Breaks the Internet" is right up your alley.<br />
<div class="separator" style="clear: both; text-align: center;">
<br /></div>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-tmdaRRRW9Xs/W_55fWB5iFI/AAAAAAACTRA/kprsMYRSR6UfJZdQqXxz8uZPDYHKzie0ACLcBGAs/s1600/Ralph_Breaks_Internet_coloring.filminspector.com_32.jpg" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="400" data-original-width="640" height="400" itemprop="image" src="https://2.bp.blogspot.com/-tmdaRRRW9Xs/W_55fWB5iFI/AAAAAAACTRA/kprsMYRSR6UfJZdQqXxz8uZPDYHKzie0ACLcBGAs/s640/Ralph_Breaks_Internet_coloring.filminspector.com_32.jpg" width="640" /></a></div>
<br />
The worldwide premiere of "Ralph Breaks the Internet" was on 5 November 2018 at the El Capitan Theatre in Los Angeles. That is where many new films premiere. Most people like "Ralph Breaks the Internet," and it has gotten positive reviews. There is no word yet on whether "Ralph Breaks the Internet" will lead to another sequel in the "Wreck-It Ralph" series. However, Ralph's character has made such a good impression on audiences that another sequel is almost inevitable. Overall, despite a pretty silly plot that is going to become archaic a lot sooner than most Disney films, "Ralph Breaks the Internet" is well worth your time.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-IroXnp9Ru1g/XmXO75ZHWRI/AAAAAAACgVs/I9DcC1drVygzvGh3w3rMPN9QdqlNyRz7ACEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_2.gif" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Ralph Breaks the Internet coloring pages coloring.filminspector.com" border="0" data-original-height="208" data-original-width="498" itemprop="image" src="https://1.bp.blogspot.com/-IroXnp9Ru1g/XmXO75ZHWRI/AAAAAAACgVs/I9DcC1drVygzvGh3w3rMPN9QdqlNyRz7ACEwYBhgL/s1600/Ralph_Breaks_the_Internet_animatedfilmreviews.filminspector.com_2.gif" /></a></div>
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/_BcYBFC6zfY" width="640"></iframe> </center>
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/T73h5bmD8Dc" width="640"></iframe></center>
<br />
<span class="updated">2020</span></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-43946403584637853682018-11-10T20:55:00.003-07:002020-03-08T23:01:58.162-06:00"Frozen" Coloring Pages Downloadable and Free<div itemscope="" itemtype="http://schema.org/Thing">
<h1>
Frozen all The Time!</h1>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-SY_gfpzrg2Y/W-eU1eqxsqI/AAAAAAACRoQ/-taFqYMsVA0N-G-zhY9PvNqcbg36cI4NQCLcBGAs/s1600/Frozen_coloring.filminspector.com_54.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="256" data-original-width="640" height="128" itemprop="image" src="https://3.bp.blogspot.com/-SY_gfpzrg2Y/W-eU1eqxsqI/AAAAAAACRoQ/-taFqYMsVA0N-G-zhY9PvNqcbg36cI4NQCLcBGAs/s320/Frozen_coloring.filminspector.com_54.jpg" width="320" /></a></div>
<br />
I'm sure you've heard about "Frozen" and don't need to be told that it is an animated feature film. However, below are various facts about "Frozen" that you may not know.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-APaZY9GTTNM/W-eU1-tuXqI/AAAAAAACRoU/djLJKOFvAywkW_zuvNtI8OiOlulo6eqHACLcBGAs/s1600/Frozen_coloring.filminspector.com_55.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="256" data-original-width="640" height="128" itemprop="image" src="https://4.bp.blogspot.com/-APaZY9GTTNM/W-eU1-tuXqI/AAAAAAACRoU/djLJKOFvAywkW_zuvNtI8OiOlulo6eqHACLcBGAs/s320/Frozen_coloring.filminspector.com_55.jpg" width="320" /></a></div>
<br />
"Frozen" (2013) is the most successful animated feature film in history in terms of money made.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/--Gl15eZFpK0/W-enmQZXOyI/AAAAAAACRqc/qgS3hoKZ-N0hO1cHMp83KXucvjh8rnm7gCLcBGAs/s1600/Frozen_coloring.filminspector.com_78.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://4.bp.blogspot.com/--Gl15eZFpK0/W-enmQZXOyI/AAAAAAACRqc/qgS3hoKZ-N0hO1cHMp83KXucvjh8rnm7gCLcBGAs/s320/Frozen_coloring.filminspector.com_78.jpg" width="320" /></a></div>
<br />
While it made over a billion dollars, "Frozen" is not in the top 100 inflation-adjusted grossing films.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-g2D5F1PtSyw/W-enrmpa8nI/AAAAAAACRqg/z0fKQTrfO3UTA9pk1-r8rKPYStd0lGUqQCLcBGAs/s1600/Frozen_coloring.filminspector.com_79.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://4.bp.blogspot.com/-g2D5F1PtSyw/W-enrmpa8nI/AAAAAAACRqg/z0fKQTrfO3UTA9pk1-r8rKPYStd0lGUqQCLcBGAs/s320/Frozen_coloring.filminspector.com_79.jpg" width="320" /></a></div>
<br />
While "Frozen" is the 13th highest-grossing film as of 2018, it is the top animated film of all time as of that year.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-R6M3VXlWdy4/W-ek-7A_hwI/AAAAAAACRqI/XfLGG3kGiaEXrnvnvcPE_1oX9FVsD3ZvwCLcBGAs/s1600/Frozen_coloring.filminspector.com_76.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="341" data-original-width="640" height="170" itemprop="image" src="https://3.bp.blogspot.com/-R6M3VXlWdy4/W-ek-7A_hwI/AAAAAAACRqI/XfLGG3kGiaEXrnvnvcPE_1oX9FVsD3ZvwCLcBGAs/s320/Frozen_coloring.filminspector.com_76.jpg" width="320" /></a></div>
<div class="separator" style="clear: both; text-align: center;">
<br /></div>
Disney's animation fortunes had been in a bit of a slump since the "Disney Renaissance" of the 1990s, but "Frozen" was as successful as any previous Disney animated feature film.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-7M-iR6J3dR0/W-elYKq3PlI/AAAAAAACRqQ/uSSdu5oJhxk0B3WNw2a3p8-_fBPpKCzbwCLcBGAs/s1600/Frozen_coloring.filminspector.com_77.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="341" data-original-width="640" height="170" itemprop="image" src="https://1.bp.blogspot.com/-7M-iR6J3dR0/W-elYKq3PlI/AAAAAAACRqQ/uSSdu5oJhxk0B3WNw2a3p8-_fBPpKCzbwCLcBGAs/s320/Frozen_coloring.filminspector.com_77.jpg" width="320" /></a></div>
<br />
"Frozen" features two Disney princesses, Anna and Elsa, who are sisters.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-DjCTCWjlfJk/W-eUpVKpu6I/AAAAAAACRmo/ipFw96C5dT4fuxVCpz5HE9uUuxH0_ZoUwCLcBGAs/s1600/Frozen_coloring.filminspector.com_28.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1089" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-DjCTCWjlfJk/W-eUpVKpu6I/AAAAAAACRmo/ipFw96C5dT4fuxVCpz5HE9uUuxH0_ZoUwCLcBGAs/s320/Frozen_coloring.filminspector.com_28.jpg" width="188" /></a></div>
<br />
<br />
One of the sisters, Elsa, has magical icy powers have inadvertently trapped her kingdom in eternal winter.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-KdXZYH5nOY8/W-eUp4I8K2I/AAAAAAACRms/bLDKDyFBhGw7uCWQN2p-lv381iapS-CHgCLcBGAs/s1600/Frozen_coloring.filminspector.com_29.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1089" data-original-width="640" height="320" itemprop="image" src="https://2.bp.blogspot.com/-KdXZYH5nOY8/W-eUp4I8K2I/AAAAAAACRms/bLDKDyFBhGw7uCWQN2p-lv381iapS-CHgCLcBGAs/s320/Frozen_coloring.filminspector.com_29.jpg" width="188" /></a></div>
<br />
Anna sets out with some companions to find Elsa to get her to make the kingdom warmer again.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-rYwTBp7FkwY/W-eUqLFBysI/AAAAAAACRmw/uoG-K_YP7OAEwTHzidqgA9n-JP0ZmrINgCLcBGAs/s1600/Frozen_coloring.filminspector.com_30.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="959" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-rYwTBp7FkwY/W-eUqLFBysI/AAAAAAACRmw/uoG-K_YP7OAEwTHzidqgA9n-JP0ZmrINgCLcBGAs/s320/Frozen_coloring.filminspector.com_30.jpg" width="213" /></a></div>
<br />
"Frozen" was adapted from a story by Hans Christian Anderson called "The Snow Queen."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-AJF4HA8ar50/W-eUqb9nooI/AAAAAAACRm0/QxRbi03Unrg_StyJXBn1WgCAPkh592zygCLcBGAs/s1600/Frozen_coloring.filminspector.com_31.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="959" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-AJF4HA8ar50/W-eUqb9nooI/AAAAAAACRm0/QxRbi03Unrg_StyJXBn1WgCAPkh592zygCLcBGAs/s320/Frozen_coloring.filminspector.com_31.jpg" width="213" /></a></div>
<br />
"Frozen" premiered on 19 November 2013 at the El Capitan Theatre in Hollywood, California.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/--L1OK0kwAh4/W-eUrlunnqI/AAAAAAACRnA/euVY82G-QZ03cozeFZ2yBPT_2oTKPPNSQCLcBGAs/s1600/Frozen_coloring.filminspector.com_32.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1058" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/--L1OK0kwAh4/W-eUrlunnqI/AAAAAAACRnA/euVY82G-QZ03cozeFZ2yBPT_2oTKPPNSQCLcBGAs/s320/Frozen_coloring.filminspector.com_32.jpg" width="193" /></a></div>
<br />
The stars of "Frozen" are voiced by Kristen Bell (Anna), Idina Menzel (Elsa), Jonathan Groff (Kristoff), and Josh Gad (Olaf).<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-NhlKIv3kKBs/W-eUrHsU0_I/AAAAAAACRm8/jFwtu4nK1mkyUP9wfuCe6PJSs1Kj8PDowCLcBGAs/s1600/Frozen_coloring.filminspector.com_33.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1058" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-NhlKIv3kKBs/W-eUrHsU0_I/AAAAAAACRm8/jFwtu4nK1mkyUP9wfuCe6PJSs1Kj8PDowCLcBGAs/s320/Frozen_coloring.filminspector.com_33.jpg" width="193" /></a></div>
<br />
One of the most distinctive aspects of "Frozen" is its musical score. The songs for "Frozen" was composed by Robert Lopez and his wife Kristen Anderson-Lopez. The background score was composed by Christophe Beck.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/--bnd6PiQfgM/W-eUrFrp97I/AAAAAAACRm4/A0nIW3WcxNUcqaI99inaxkTrMJXUrmjVQCLcBGAs/s1600/Frozen_coloring.filminspector.com_34.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="640" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/--bnd6PiQfgM/W-eUrFrp97I/AAAAAAACRm4/A0nIW3WcxNUcqaI99inaxkTrMJXUrmjVQCLcBGAs/s320/Frozen_coloring.filminspector.com_34.jpg" width="320" /></a></div>
<br />
"Frozen" won the Academy Award for Best Original Song, which was "Let It Go."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-ax9rsVRLf-U/W-eUr6SsmbI/AAAAAAACRnE/Jl_oKuZWmJYj3rRQ-9R1hVUFk-Le_epKACLcBGAs/s1600/Frozen_coloring.filminspector.com_35.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="640" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-ax9rsVRLf-U/W-eUr6SsmbI/AAAAAAACRnE/Jl_oKuZWmJYj3rRQ-9R1hVUFk-Le_epKACLcBGAs/s320/Frozen_coloring.filminspector.com_35.jpg" width="320" /></a></div>
<br />
"Frozen" also won the Oscar for Best Animated Feature Film.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-Rp6JiBHV5YY/W-eUsVbs9vI/AAAAAAACRnI/RcKBU04e8fodxsoAck5YcIMQ3S4dfyLaQCLcBGAs/s1600/Frozen_coloring.filminspector.com_36.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="634" data-original-width="640" height="317" itemprop="image" src="https://4.bp.blogspot.com/-Rp6JiBHV5YY/W-eUsVbs9vI/AAAAAAACRnI/RcKBU04e8fodxsoAck5YcIMQ3S4dfyLaQCLcBGAs/s320/Frozen_coloring.filminspector.com_36.jpg" width="320" /></a></div>
<br />
There was a short animated sequel to "Frozen," "Frozen Fever." It was released on 13 March 2015.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-LusGx7LJ3B4/W-eUs9z3IcI/AAAAAAACRnM/JabigDBU070EVFBUK6SjEW4fkIJhYMXFACLcBGAs/s1600/Frozen_coloring.filminspector.com_37.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="634" data-original-width="640" height="317" itemprop="image" src="https://1.bp.blogspot.com/-LusGx7LJ3B4/W-eUs9z3IcI/AAAAAAACRnM/JabigDBU070EVFBUK6SjEW4fkIJhYMXFACLcBGAs/s320/Frozen_coloring.filminspector.com_37.jpg" width="320" /></a></div>
<br />
There also was an animated featurette called "Olaf's Frozen Adventure," which was released on 22 November 2017.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-UYd-FLVLZ0k/W-eUtVEWIxI/AAAAAAACRnQ/0-zZIkDXYvc6sLnl2U4Z0IxYiZ6-zv56QCLcBGAs/s1600/Frozen_coloring.filminspector.com_38.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1014" data-original-width="640" height="320" itemprop="image" src="https://4.bp.blogspot.com/-UYd-FLVLZ0k/W-eUtVEWIxI/AAAAAAACRnQ/0-zZIkDXYvc6sLnl2U4Z0IxYiZ6-zv56QCLcBGAs/s320/Frozen_coloring.filminspector.com_38.jpg" width="201" /></a></div>
<br />
"Frozen II" is scheduled for release on 22 November 2019.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-SP6aeBfz044/W-eUt3z9nqI/AAAAAAACRnU/vYiEzX5jA48Rerax6YlgUQxHWvaoJ8TuwCLcBGAs/s1600/Frozen_coloring.filminspector.com_39.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1014" data-original-width="640" height="320" itemprop="image" src="https://1.bp.blogspot.com/-SP6aeBfz044/W-eUt3z9nqI/AAAAAAACRnU/vYiEzX5jA48Rerax6YlgUQxHWvaoJ8TuwCLcBGAs/s320/Frozen_coloring.filminspector.com_39.jpg" width="201" /></a></div>
<br />
<br />
Much of the music in "Frozen" was done by traditional Norwegian Sámi music.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-AVO3XctSdnY/W-eUuW_8Y0I/AAAAAAACRnY/HPBb6slzY00hc581wcu7j8AahkOW9T3vQCLcBGAs/s1600/Frozen_coloring.filminspector.com_40.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://4.bp.blogspot.com/-AVO3XctSdnY/W-eUuW_8Y0I/AAAAAAACRnY/HPBb6slzY00hc581wcu7j8AahkOW9T3vQCLcBGAs/s320/Frozen_coloring.filminspector.com_40.jpg" width="320" /></a></div>
<br />
"Frozen" did especially well in Japan.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-BJtUk1W47FE/W-eUuxhovII/AAAAAAACRnc/Tn6nt3Vv7EIilYVErJfo23NGMrvNgspQgCLcBGAs/s1600/Frozen_coloring.filminspector.com_41.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://2.bp.blogspot.com/-BJtUk1W47FE/W-eUuxhovII/AAAAAAACRnc/Tn6nt3Vv7EIilYVErJfo23NGMrvNgspQgCLcBGAs/s320/Frozen_coloring.filminspector.com_41.jpg" width="320" /></a></div>
<br />
"Frozen" has a traditional wisecracking sidekick in the form of snowman Olaf.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-06sJSaRQoBo/W-eUvZdaYJI/AAAAAAACRng/v7aQc6BOOZkyTx_w9L3eT7YK5RBS2JfgACLcBGAs/s1600/Frozen_coloring.filminspector.com_42.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="384" data-original-width="640" height="192" itemprop="image" src="https://1.bp.blogspot.com/-06sJSaRQoBo/W-eUvZdaYJI/AAAAAAACRng/v7aQc6BOOZkyTx_w9L3eT7YK5RBS2JfgACLcBGAs/s320/Frozen_coloring.filminspector.com_42.jpg" width="320" /></a></div>
<br />
The sequel to "Frozen" is being created by Chris Buck and Jennifer Lee.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-KESCc_lNmkw/W-eUv6kihjI/AAAAAAACRnk/RlIt-VkbE8Eb4LpBuIUcarq_HC9LPIQNgCLcBGAs/s1600/Frozen_coloring.filminspector.com_43.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="384" data-original-width="640" height="192" itemprop="image" src="https://4.bp.blogspot.com/-KESCc_lNmkw/W-eUv6kihjI/AAAAAAACRnk/RlIt-VkbE8Eb4LpBuIUcarq_HC9LPIQNgCLcBGAs/s320/Frozen_coloring.filminspector.com_43.jpg" width="320" /></a></div>
<br />
Bell, Menzel, and Gad will appear in "Frozen 2."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-vX7DY1lsURc/W-eUwYX5LKI/AAAAAAACRno/w567XKHOgg8iBY6k0_ukUbXduSTTh3sYACLcBGAs/s1600/Frozen_coloring.filminspector.com_44.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="238" data-original-width="640" height="119" itemprop="image" src="https://1.bp.blogspot.com/-vX7DY1lsURc/W-eUwYX5LKI/AAAAAAACRno/w567XKHOgg8iBY6k0_ukUbXduSTTh3sYACLcBGAs/s320/Frozen_coloring.filminspector.com_44.jpg" width="320" /></a></div>
<br />
In "Frozen," Anna is 18, while Elsa is 21.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-KNiHlmnGSQM/W-eUwzodhcI/AAAAAAACRns/-Jq_ABE-OCAiAaCp4Qh4wWL5kujRBTiRgCLcBGAs/s1600/Frozen_coloring.filminspector.com_45.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="238" data-original-width="640" height="119" itemprop="image" src="https://1.bp.blogspot.com/-KNiHlmnGSQM/W-eUwzodhcI/AAAAAAACRns/-Jq_ABE-OCAiAaCp4Qh4wWL5kujRBTiRgCLcBGAs/s320/Frozen_coloring.filminspector.com_45.jpg" width="320" /></a></div>
<br />
Elsa becomes a queen in "Frozen." Thus, technically, Elsa is not a princess at the end of "Frozen."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-Ovy_dlzDBuk/W-eUxV2U4GI/AAAAAAACRnw/9lEzF3EqB7gK-Q7iueLBiAdATH2Bkta2gCLcBGAs/s1600/Frozen_coloring.filminspector.com_46.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="426" data-original-width="640" height="213" itemprop="image" src="https://2.bp.blogspot.com/-Ovy_dlzDBuk/W-eUxV2U4GI/AAAAAAACRnw/9lEzF3EqB7gK-Q7iueLBiAdATH2Bkta2gCLcBGAs/s320/Frozen_coloring.filminspector.com_46.jpg" width="320" /></a></div>
<br />
Three actresses sing "Do You Want to Build a Snowman": Katie Lopez, Agatha Lee Monn, and Kristen Bell.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-aSOh8TlGEV0/W-eUxwNMQaI/AAAAAAACRn0/ztkxZL20Mlol6tadTVankO-pZKrMnuT9ACLcBGAs/s1600/Frozen_coloring.filminspector.com_47.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="426" data-original-width="640" height="213" itemprop="image" src="https://3.bp.blogspot.com/-aSOh8TlGEV0/W-eUxwNMQaI/AAAAAAACRn0/ztkxZL20Mlol6tadTVankO-pZKrMnuT9ACLcBGAs/s320/Frozen_coloring.filminspector.com_47.jpg" width="320" /></a></div>
<br />
"Frozen" was no. 1 at the box office for 16 straight weeks in Japan.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-7IO6D469fAw/W-eUyeQ4NVI/AAAAAAACRn4/-88Ee0nLb6MgIwnK-qP6pT7QDcn4NVKswCLcBGAs/s1600/Frozen_coloring.filminspector.com_48.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://3.bp.blogspot.com/-7IO6D469fAw/W-eUyeQ4NVI/AAAAAAACRn4/-88Ee0nLb6MgIwnK-qP6pT7QDcn4NVKswCLcBGAs/s320/Frozen_coloring.filminspector.com_48.jpg" width="320" /></a></div>
<br />
"Frozen" broke the Japanese record for animated feature films. It became the second-highest-grossing film behind "Titanic."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-23co6aYDzSQ/W-eUy8tskuI/AAAAAAACRn8/jNOOdHku6Cga5g58NpOoinoYpUKxLvJEwCLcBGAs/s1600/Frozen_coloring.filminspector.com_49.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://1.bp.blogspot.com/-23co6aYDzSQ/W-eUy8tskuI/AAAAAAACRn8/jNOOdHku6Cga5g58NpOoinoYpUKxLvJEwCLcBGAs/s320/Frozen_coloring.filminspector.com_49.jpg" width="320" /></a></div>
<br />
There were 600 people working for two-and-a-half years for a total of 3 million hours to complete "Frozen."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-uJl6O4yNz-o/W-eUzQsPdUI/AAAAAAACRoA/NkhF36gA0jY6XFbasorPn7Mar3lmzYcWgCLcBGAs/s1600/Frozen_coloring.filminspector.com_50.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="384" data-original-width="640" height="192" itemprop="image" src="https://2.bp.blogspot.com/-uJl6O4yNz-o/W-eUzQsPdUI/AAAAAAACRoA/NkhF36gA0jY6XFbasorPn7Mar3lmzYcWgCLcBGAs/s320/Frozen_coloring.filminspector.com_50.jpg" width="320" /></a></div>
<br />
The soundtrack of "Frozen" spent 13 weeks at No. 1 on the Billboard album chart.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-utJkr5Y9PI0/W-eUz9DmsjI/AAAAAAACRoE/fl5PAnFaPewyqnXlN8h0Gh5tblVoHfAJQCLcBGAs/s1600/Frozen_coloring.filminspector.com_51.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="384" data-original-width="640" height="192" itemprop="image" src="https://3.bp.blogspot.com/-utJkr5Y9PI0/W-eUz9DmsjI/AAAAAAACRoE/fl5PAnFaPewyqnXlN8h0Gh5tblVoHfAJQCLcBGAs/s320/Frozen_coloring.filminspector.com_51.jpg" width="320" /></a></div>
<br />
Santino Fontana voices Hans, Anna's suitor.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-5d9PgruipXM/W-eU0Qak0xI/AAAAAAACRoI/IMGCLnU0mYMATgmDNjpH3wb0H-PKl0J6wCLcBGAs/s1600/Frozen_coloring.filminspector.com_52.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="736" data-original-width="640" height="320" itemprop="image" src="https://2.bp.blogspot.com/-5d9PgruipXM/W-eU0Qak0xI/AAAAAAACRoI/IMGCLnU0mYMATgmDNjpH3wb0H-PKl0J6wCLcBGAs/s320/Frozen_coloring.filminspector.com_52.jpg" width="278" /></a></div>
<br />
"Frozen" was the highest-grossing animated film of 2013 and the third-highest overall.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-JoxS3nu5918/W-eU0ywRlXI/AAAAAAACRoM/zFwkRAzdMQYN7-W4J2cvKUfSqT5mPQ5BQCLcBGAs/s1600/Frozen_coloring.filminspector.com_53.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="736" data-original-width="640" height="320" itemprop="image" src="https://2.bp.blogspot.com/-JoxS3nu5918/W-eU0ywRlXI/AAAAAAACRoM/zFwkRAzdMQYN7-W4J2cvKUfSqT5mPQ5BQCLcBGAs/s320/Frozen_coloring.filminspector.com_53.jpg" width="278" /></a></div>
<br />
Jennifer Lee, one of the co-directors, had no animation experience.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-yO9HSjcCKTE/W-eUpWMBOnI/AAAAAAACRmg/j0EJzKZEDAga8A9kQzktU5dvNezLisuKQCLcBGAs/s1600/Frozen_coloring.filminspector.com_26.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="915" data-original-width="640" height="320" itemprop="image" src="https://2.bp.blogspot.com/-yO9HSjcCKTE/W-eUpWMBOnI/AAAAAAACRmg/j0EJzKZEDAga8A9kQzktU5dvNezLisuKQCLcBGAs/s320/Frozen_coloring.filminspector.com_26.jpg" title="" width="223" /></a></div>
<br />
Co-director Chris Buck is an animation specialist.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-3L5dGKQaQAw/W-eUpR0K4RI/AAAAAAACRmk/VHU8Fmr08nMCZmj4GkxqWJP2JHCSMlhkQCLcBGAs/s1600/Frozen_coloring.filminspector.com_27.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="915" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-3L5dGKQaQAw/W-eUpR0K4RI/AAAAAAACRmk/VHU8Fmr08nMCZmj4GkxqWJP2JHCSMlhkQCLcBGAs/s320/Frozen_coloring.filminspector.com_27.jpg" width="223" /></a></div>
<br />
Elsa's castle is very complex and took nine months to complete for the film.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-00oxVP4uqFA/W-eU2W_wA_I/AAAAAAACRoY/BkGORlp3_FIv7K_4882KwII2vmDbFCMhwCLcBGAs/s1600/Frozen_coloring.filminspector.com_56.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="426" data-original-width="640" height="213" itemprop="image" src="https://3.bp.blogspot.com/-00oxVP4uqFA/W-eU2W_wA_I/AAAAAAACRoY/BkGORlp3_FIv7K_4882KwII2vmDbFCMhwCLcBGAs/s320/Frozen_coloring.filminspector.com_56.jpg" width="320" /></a></div>
<br />
"Frozen" made over a billion dollars worldwide.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-VyBplEf3vZE/W-eU24ku9EI/AAAAAAACRoc/tU0NqPHyk9YxuTP4w0gE5hVspa7_uOeWgCLcBGAs/s1600/Frozen_coloring.filminspector.com_57.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="426" data-original-width="640" height="213" itemprop="image" src="https://4.bp.blogspot.com/-VyBplEf3vZE/W-eU24ku9EI/AAAAAAACRoc/tU0NqPHyk9YxuTP4w0gE5hVspa7_uOeWgCLcBGAs/s320/Frozen_coloring.filminspector.com_57.jpg" width="320" /></a></div>
<br />
"Toy Story 3" (2010) was the first animated film to make a billion dollars.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-FGSn032mPWk/W-eU3RzQJzI/AAAAAAACRog/gvIx-aTpEVkzOkn-vZ1F7OvySMP6HH85wCLcBGAs/s1600/Frozen_coloring.filminspector.com_58.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="370" data-original-width="640" height="185" itemprop="image" src="https://4.bp.blogspot.com/-FGSn032mPWk/W-eU3RzQJzI/AAAAAAACRog/gvIx-aTpEVkzOkn-vZ1F7OvySMP6HH85wCLcBGAs/s320/Frozen_coloring.filminspector.com_58.jpg" width="320" /></a></div>
<br />
All of the songs in "Frozen" were written on the same day.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-AFoSmIBi3FA/W-eU34Q8CsI/AAAAAAACRok/Nk0hwheTBvsQ5f55yESaEYJ2dx7vMkrCgCLcBGAs/s1600/Frozen_coloring.filminspector.com_59.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="370" data-original-width="640" height="185" itemprop="image" src="https://1.bp.blogspot.com/-AFoSmIBi3FA/W-eU34Q8CsI/AAAAAAACRok/Nk0hwheTBvsQ5f55yESaEYJ2dx7vMkrCgCLcBGAs/s320/Frozen_coloring.filminspector.com_59.jpg" width="320" /></a></div>
<br />
"Frozen" became the first animated film to sell over ten million tickets in South Korea.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-Bz0LvlTrLIE/W-eU4Wj3ykI/AAAAAAACRoo/v4lGLmb3pTsDQ2hFcJgSvSB9rEHqk6vmwCLcBGAs/s1600/Frozen_coloring.filminspector.com_60.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://3.bp.blogspot.com/-Bz0LvlTrLIE/W-eU4Wj3ykI/AAAAAAACRoo/v4lGLmb3pTsDQ2hFcJgSvSB9rEHqk6vmwCLcBGAs/s320/Frozen_coloring.filminspector.com_60.jpg" width="320" /></a></div>
<br />
Elsa's mountaintop retreat is based upon a mountain peak in Whistler, British Columbia.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-G69q4Lue7tk/W-eU44tlDWI/AAAAAAACRos/a0DY58p5lx4QpwzrURzFt5-BWwWPbZQBwCLcBGAs/s1600/Frozen_coloring.filminspector.com_61.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="360" data-original-width="640" height="180" itemprop="image" src="https://1.bp.blogspot.com/-G69q4Lue7tk/W-eU44tlDWI/AAAAAAACRos/a0DY58p5lx4QpwzrURzFt5-BWwWPbZQBwCLcBGAs/s320/Frozen_coloring.filminspector.com_61.jpg" width="320" /></a></div>
<br />
"Frozen" is in 2:35:1 aspect ratio, which is unusual and only the second Disney film to have that ratio.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-gms55_xKgq4/W-eU5e_1yTI/AAAAAAACRow/L-fh8ViQY7w9JPrsqCN2IsmyZ1I3m08JwCLcBGAs/s1600/Frozen_coloring.filminspector.com_62.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="479" data-original-width="640" height="239" itemprop="image" src="https://1.bp.blogspot.com/-gms55_xKgq4/W-eU5e_1yTI/AAAAAAACRow/L-fh8ViQY7w9JPrsqCN2IsmyZ1I3m08JwCLcBGAs/s320/Frozen_coloring.filminspector.com_62.jpg" width="320" /></a></div>
<br />
Another Disney animated feature film based on a story by Hans Christian Anderson is "The Little Mermaid" (1989), which was a major success and began the "Disney Renaissance."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-zn7SvyjsAkc/W-eU58HUqaI/AAAAAAACRo0/h7LEs2CpezYhMexRbbfBgeODwNraQomzACLcBGAs/s1600/Frozen_coloring.filminspector.com_63.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="479" data-original-width="640" height="239" itemprop="image" src="https://2.bp.blogspot.com/-zn7SvyjsAkc/W-eU58HUqaI/AAAAAAACRo0/h7LEs2CpezYhMexRbbfBgeODwNraQomzACLcBGAs/s320/Frozen_coloring.filminspector.com_63.jpg" width="320" /></a></div>
<br />
"Frozen" had an estimated budget of $150 million. It returned several times that.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-YWXyralZgEc/W-eU6R63KvI/AAAAAAACRo4/YqByY5_ehKcQSLYQ2x2BuphxUiqmPLg9QCLcBGAs/s1600/Frozen_coloring.filminspector.com_64.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="358" data-original-width="640" height="179" itemprop="image" src="https://3.bp.blogspot.com/-YWXyralZgEc/W-eU6R63KvI/AAAAAAACRo4/YqByY5_ehKcQSLYQ2x2BuphxUiqmPLg9QCLcBGAs/s320/Frozen_coloring.filminspector.com_64.jpg" width="320" /></a></div>
<br />
"Frozen" made $400 million in the United States alone.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-O3Pu4dbiOR4/W-eU68cakpI/AAAAAAACRo8/yo-jsKzWlWELHMhAkMCaKpfvbWdZ4qI9ACLcBGAs/s1600/Frozen_coloring.filminspector.com_65.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="358" data-original-width="640" height="179" itemprop="image" src="https://4.bp.blogspot.com/-O3Pu4dbiOR4/W-eU68cakpI/AAAAAAACRo8/yo-jsKzWlWELHMhAkMCaKpfvbWdZ4qI9ACLcBGAs/s320/Frozen_coloring.filminspector.com_65.jpg" width="320" /></a></div>
<br />
The cumulative worldwide gross of "Frozen" is $1.276 billion.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-t53c0mSxoLg/W-eU7SqgUXI/AAAAAAACRpA/68fuNADhsTIp-C13JGmJzlj3W9qaya3kgCLcBGAs/s1600/Frozen_coloring.filminspector.com_66.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="930" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-t53c0mSxoLg/W-eU7SqgUXI/AAAAAAACRpA/68fuNADhsTIp-C13JGmJzlj3W9qaya3kgCLcBGAs/s320/Frozen_coloring.filminspector.com_66.jpg" width="220" /></a></div>
<br />
Rapunzel and Eugene from "Tangled" make a brief appearance in "Frozen." This happens when the castle gates open.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-kYOXJFLyHBc/W-eU8McjiAI/AAAAAAACRpE/6ZCIyblyZeEjW9iu2VNppyO4QGpE1wTDwCLcBGAs/s1600/Frozen_coloring.filminspector.com_67.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="930" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-kYOXJFLyHBc/W-eU8McjiAI/AAAAAAACRpE/6ZCIyblyZeEjW9iu2VNppyO4QGpE1wTDwCLcBGAs/s320/Frozen_coloring.filminspector.com_67.jpg" width="220" /></a></div>
<br />
Animators worked with a real reindeer while doing the animation for "Frozen."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-TemraAe5T6A/W-eU8XG-B3I/AAAAAAACRpI/N_Zc3Zv0iYQf1GTxNsqne5oN7EqemSlPQCLcBGAs/s1600/Frozen_coloring.filminspector.com_68.jpg" imageanchor="1"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="921" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-TemraAe5T6A/W-eU8XG-B3I/AAAAAAACRpI/N_Zc3Zv0iYQf1GTxNsqne5oN7EqemSlPQCLcBGAs/s1600/Frozen_coloring.filminspector.com_68.jpg" width="222" /></a></div>
<br />
Both Kristen Bell and Idina Menzel auditioned for, but did not get, the voice role of Rapunzel in "Tangled."<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-_YFC6gYrpWw/W-eU9AY77ZI/AAAAAAACRpM/o4kq1NLiFtQFKCLvh-zISvULygropqVQwCLcBGAs/s1600/Frozen_coloring.filminspector.com_69.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="921" data-original-width="640" height="320" itemprop="image" src="https://2.bp.blogspot.com/-_YFC6gYrpWw/W-eU9AY77ZI/AAAAAAACRpM/o4kq1NLiFtQFKCLvh-zISvULygropqVQwCLcBGAs/s320/Frozen_coloring.filminspector.com_69.jpg" width="222" /></a></div>
<br />
The screenwriter of "Frozen" was Jennifer Lee.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-qC2VuGruJuo/W-eU9TBYRrI/AAAAAAACRpQ/01KLlbJxtKUiU8x-KLOaCmBHi2hhx9w6ACLcBGAs/s1600/Frozen_coloring.filminspector.com_70.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1600" data-original-width="589" height="320" itemprop="image" src="https://1.bp.blogspot.com/-qC2VuGruJuo/W-eU9TBYRrI/AAAAAAACRpQ/01KLlbJxtKUiU8x-KLOaCmBHi2hhx9w6ACLcBGAs/s320/Frozen_coloring.filminspector.com_70.jpg" width="117" /></a></div>
<br />
One frame alone in "Frozen" took 132 hours to render.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-vXUMGFqx1lw/W-eU-N9mXCI/AAAAAAACRpU/zQkS6QH6gp8CdmBKTqMA5NPfEAdFPnZywCLcBGAs/s1600/Frozen_coloring.filminspector.com_71.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="1600" data-original-width="589" height="320" itemprop="image" src="https://1.bp.blogspot.com/-vXUMGFqx1lw/W-eU-N9mXCI/AAAAAAACRpU/zQkS6QH6gp8CdmBKTqMA5NPfEAdFPnZywCLcBGAs/s320/Frozen_coloring.filminspector.com_71.jpg" width="117" /></a></div>
<br />
Alan Tudyk, who voices the Duke of Weselton, also voiced King Candy in "Wreck-It Ralph" (2012).<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-v-bV__0qEJs/W-eU-eRKx4I/AAAAAAACRpY/FoAjVreOSmMbhDpLtBmUHI_6FSrZhUQWwCLcBGAs/s1600/Frozen_coloring.filminspector.com_72.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="956" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-v-bV__0qEJs/W-eU-eRKx4I/AAAAAAACRpY/FoAjVreOSmMbhDpLtBmUHI_6FSrZhUQWwCLcBGAs/s320/Frozen_coloring.filminspector.com_72.jpg" width="214" /></a></div>
<br />
Disney announced the title of "Frozen" on 22 December 2011.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-z8B_205Xhmg/W-eU_KClLCI/AAAAAAACRpc/vMKOqOhR6zUjki_fIaPSMrJSGvgHvb9vACLcBGAs/s1600/Frozen_coloring.filminspector.com_73.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="956" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-z8B_205Xhmg/W-eU_KClLCI/AAAAAAACRpc/vMKOqOhR6zUjki_fIaPSMrJSGvgHvb9vACLcBGAs/s320/Frozen_coloring.filminspector.com_73.jpg" width="214" /></a></div>
<br />
"Frozen" was made using computer animation. Disney briefly tried using traditional animation right before "Frozen," but it proved to be more of a problem than it was worth.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-PFzoQv2Zl64/W-eU_h1z-lI/AAAAAAACRpg/OJ2Jpdgi6Xwr2hugedMhAm4mb4VX64QMACLcBGAs/s1600/Frozen_coloring.filminspector.com_74.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="960" data-original-width="640" height="320" itemprop="image" src="https://3.bp.blogspot.com/-PFzoQv2Zl64/W-eU_h1z-lI/AAAAAAACRpg/OJ2Jpdgi6Xwr2hugedMhAm4mb4VX64QMACLcBGAs/s320/Frozen_coloring.filminspector.com_74.jpg" width="213" /></a></div>
<br />
The first and last words spoken in "Frozen" are Elsa.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-qa15nTHSe9U/W-eVAEZfzWI/AAAAAAACRpk/9ijioBN7-yARoe4NZf6cdVSLrLi1JdtdQCLcBGAs/s1600/Frozen_coloring.filminspector.com_75.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen coloring pages free and downloadable animatedfilmreviews.filminspector.com" border="0" data-original-height="960" data-original-width="640" height="320" itemprop="image" src="https://4.bp.blogspot.com/-qa15nTHSe9U/W-eVAEZfzWI/AAAAAAACRpk/9ijioBN7-yARoe4NZf6cdVSLrLi1JdtdQCLcBGAs/s320/Frozen_coloring.filminspector.com_75.jpg" width="213" /></a></div>
<br />
<span class="updated">2020</span>
</div>
Unknownnoreply@blogger.com0126 W Elm Ave, Fullerton, CA 92832, USA33.86438392875182 -117.9254274055638228.213861428751819 -128.47230240556382 39.514906428751821 -107.37855240556382tag:blogger.com,1999:blog-3476622805364190755.post-72812543567229534902016-07-16T11:30:00.001-06:002020-03-08T23:00:13.347-06:00Update On Frozen II<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<h1>
Elsa and Anna Together Again!</h1>
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/--U_WFHuHbMA/V4pskYrBFbI/AAAAAAAB1N8/Y57lnF5cZ5YQG8svzxRVpRTyG7i51Di4gCLcB/s1600/Frozen_II_animatedfilmreviews.filminspector.com_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com Anna Elsa" border="0" itemprop="image" src="https://2.bp.blogspot.com/--U_WFHuHbMA/V4pskYrBFbI/AAAAAAAB1N8/Y57lnF5cZ5YQG8svzxRVpRTyG7i51Di4gCLcB/s1600/Frozen_II_animatedfilmreviews.filminspector.com_1.jpg" title="" /></a></div>
<br />
Plans are firming up for the sequel to "Frozen," which is in the planning stages and is a definite "Go." Just to call it something, for now, I'll call it "<b itemprop="name">Frozen II</b>." For those who need to know the obvious and not-so-obvious facts about the sequel:<br />
<ul style="text-align: left;">
<li>"Frozen II" (or whatever they choose to call it) will not be out before 2018 at the absolute earliest. Disney has three major feature films in line ahead of it and there simply isn't room on the schedule before then - and likely for some time afterward. My own guess is that the sequel will appear during the holiday season in 2020, but it could be a year earlier or even later.</li>
<li>Kristen Bell and Idina Menzel will both return.</li>
<li>Jennifer Lee will return to direct.</li>
<li>Olaf will return and probably get a new girlfriend - who may factor into the story significantly.</li>
<li>The characters will have new costumes, certainly Elsa and almost certainly Anna.</li>
</ul>
Aside from that, everything is guesswork and will remain so until Disney releases a trailer or artwork, which likely won't be before 2018 at the earliest. While the prospect of a sequel is exciting, don't hold your breath, this isn't happening for some time yet.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-_BXzCwBAl1k/V4ptZsN6nVI/AAAAAAAB1OE/Oad57zravJ4yWhQGN-k1Gv3mTkGUR4xpgCLcB/s1600/Frozen_II_animatedfilmreviews.filminspector.com_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Frozen II animatedfilmreviews.filminspector.com Elsa" border="0" height="398" itemprop="image" src="https://3.bp.blogspot.com/-_BXzCwBAl1k/V4ptZsN6nVI/AAAAAAAB1OE/Oad57zravJ4yWhQGN-k1Gv3mTkGUR4xpgCLcB/s640/Frozen_II_animatedfilmreviews.filminspector.com_2.jpg" title="" width="640" /></a></div>
<br />
<b>UPDATE</b>: The first official teaser trailer for "Frozen 2" is below, released on February 13, 2019.<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/eSLe4HuKuK0" width="640"></iframe></center>
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-20004476315037218612016-07-16T10:42:00.000-06:002020-03-08T22:58:56.831-06:00Walt Disney: Money Doesn't Excite Me<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Person">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-pvCyi6QEVCM/V4piVLoI9lI/AAAAAAAB1M0/gUUfRCUHXBISlWpzNhPf6AJcyJi6SLJMQCLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_12.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Walt Disney animatedfilmreviews.filminspector.com Mickey Mouse" border="0" itemprop="image" src="https://1.bp.blogspot.com/-pvCyi6QEVCM/V4piVLoI9lI/AAAAAAAB1M0/gUUfRCUHXBISlWpzNhPf6AJcyJi6SLJMQCLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_12.jpg" title="" /></a></div>
<br />
<b itemprop="name">Walt Disney: Money Doesn't Excite Me.</b> It's always a good time of year to remember Walt Disney. It doesn't have to be his birthday.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-oXRYrM9nOPo/V4piVDhXiXI/AAAAAAAB1M4/vlCoQHsZfJM1sTOOsge7ORjWbYycvGMxQCLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_13.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Walt Disney animatedfilmreviews.filminspector.com Mickey Mouse" border="0" itemprop="image" src="https://3.bp.blogspot.com/-oXRYrM9nOPo/V4piVDhXiXI/AAAAAAAB1M4/vlCoQHsZfJM1sTOOsge7ORjWbYycvGMxQCLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_13.jpg" title="" /></a></div>
<br />
Imagine the freedom to indulge your creativity like Walt Disney. He managed to create an entire industry - animated feature films. His characters remain as vibrant as the day he created them.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-zgBoXalltcE/V4piVSc2XJI/AAAAAAAB1M8/33J16meiVkkx2nz9lkFmWrGxap3TaZUNACLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_14.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Walt Disney animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-zgBoXalltcE/V4piVSc2XJI/AAAAAAAB1M8/33J16meiVkkx2nz9lkFmWrGxap3TaZUNACLcB/s1600/Walt_Disney_animatedfilmreviews.filminspector.com_14.jpg" title="" /></a></div>
<br />
<div class="separator" style="clear: both; text-align: center;">
</div>
<span class="updated">2020</span>
</div>
<br /></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-64538020139745948262016-05-08T12:11:00.001-06:002020-03-08T22:57:19.043-06:00Allumette: Something 3D/VR Beautiful<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-tdSX3wL42Fo/Vy97LoFdbcI/AAAAAAAByh8/8OYNGd4MUQ4xFMehJHo7jIVnxMCw7tkpQCLcB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios Penrose Studios" border="0" itemprop="image" src="https://4.bp.blogspot.com/-tdSX3wL42Fo/Vy97LoFdbcI/AAAAAAAByh8/8OYNGd4MUQ4xFMehJHo7jIVnxMCw7tkpQCLcB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_5.jpg" title="" /></a></div>
<div class="separator" style="clear: both; text-align: center;">
<br /></div>
<b itemprop="name">Allumette: Something 3D/VR Beautiful.</b><br />
<br />
The animation field is ready for "the next best thing." Let's face it: animation basically hasn't progressed that much since the Disney Golden Age. Yes, the techniques have improved, the colors are better, everything is more "real." However, you basically are looking at caricatures of people and things in a 2D environment. I even would bet you that I could show a few "improvements" that are nothing of the sort.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-6UyvajVLJqA/Vy97LwrYQ0I/AAAAAAAByiE/ejeqDoWE2mAtHIinyDsdsRXhe_D4iaQRQCLcB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_7.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" height="422" itemprop="image" src="https://4.bp.blogspot.com/-6UyvajVLJqA/Vy97LwrYQ0I/AAAAAAAByiE/ejeqDoWE2mAtHIinyDsdsRXhe_D4iaQRQCLcB/s640/Allumette_3D_animatedfilmreviews.filminspector.com_7.jpg" width="640" /></a></div>
<br />
You may not buy that argument, because new animation is undeniably snazzier, with better audio (a vastly overlooked aspect of modern animation) and lots of computer techniques that get the look sharper. However, what the industry really needs is to break out of the 2D world and actually present a more realistic portrait of, well, reality. That would be a game-changer... if done right.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-K5ghfqQ2ZQI/Vy97LtjRpxI/AAAAAAAByiA/WoqmEsBBXugApbNzKPXTym9NzQVLOux0gCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_6.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" itemprop="image" src="https://1.bp.blogspot.com/-K5ghfqQ2ZQI/Vy97LtjRpxI/AAAAAAAByiA/WoqmEsBBXugApbNzKPXTym9NzQVLOux0gCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_6.jpg" /></a></div>
<br />
So far, I haven't seen much progress in that area. I am not a fan of 3D television or 3D films, but the animation is one area where 3D could make a huge difference. Combine it with virtual reality, and it may be revolutionary. A promising pioneer in the field is <span itemprop="productionCompany">Penrose Studios</span>.<br />
<br />
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="https://4.bp.blogspot.com/-owt__UGSpys/Vy98No3sQ4I/AAAAAAAByiQ/WDQHDWQuudEEVK2C2UKZj8U6ua5vt8RkwCLcB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_8.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" height="360" itemprop="image" src="https://4.bp.blogspot.com/-owt__UGSpys/Vy98No3sQ4I/AAAAAAAByiQ/WDQHDWQuudEEVK2C2UKZj8U6ua5vt8RkwCLcB/s640/Allumette_3D_animatedfilmreviews.filminspector.com_8.jpg" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Eugene Chung and staff working on "Allumette."</td></tr>
</tbody></table>
<span itemprop="director" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Eugene Chung</span></span>, a money guy ("venture capitalist") who sipped some coffee at Pixar, is behind Penrose. He is credited as a "writer and director" at the studio, so he is a creative type as well. Chung hooked up with Oculus, the virtual reality outfit, which then got acquired by Facebook, and maybe that's where a lot of that money came from. Chung seems to only stay at places briefly; he was out of Oculus after only about a year to found Penrose not much more than a year ago. So, this is brand new and in a state of flux.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-E5xt47lvL38/Vy97KKCdGHI/AAAAAAAByhs/ectVe67grpYN84RbApROx4J-VCAMEiGaQCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://2.bp.blogspot.com/-E5xt47lvL38/Vy97KKCdGHI/AAAAAAAByhs/ectVe67grpYN84RbApROx4J-VCAMEiGaQCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_1.jpg" /></a></div>
<br />
It is too early to say where this new field of animation is headed. I could throw more facts at you about this, but the proof will be in the pudding. 3D is one of those things that keeps getting hyped and then disappoints, so let's not get all excited to no purpose. Virtual reality, combined with stellar animation, would be a completely new sort of experience that will be worth checking out. In my very casual opinion, though, virtual reality itself still needs a lot of development to really realize its potential.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://3.bp.blogspot.com/-4M_tOk2Q7NE/Vy97LTbuCFI/AAAAAAAByh4/SO3wQUDqBeczG_BUw-LT7-fHoCNVdo_rACKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" itemprop="image" src="https://3.bp.blogspot.com/-4M_tOk2Q7NE/Vy97LTbuCFI/AAAAAAAByh4/SO3wQUDqBeczG_BUw-LT7-fHoCNVdo_rACKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_4.jpg" /></a></div>
<br />
So far, Chung has been involved with only two films: "Lost," a short film that Oculus and he worked on; and "<b itemprop="name">Allumette</b>," a full children's story that Chung and his team worked up after he left Oculus and began Penrose. Allumette is what we are all waiting to see, and it is not out yet anywhere as far as I can tell. Chung posits that "this is that next major medium of human storytelling." Well, that's a pretty grand statement. We shall see. I am willing to give them a chance, and that isn't always the case.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-LPnQa6hDJ3M/Vy97KiOcDrI/AAAAAAAByhw/FHxtvHbRrfU1AdAC9JvycRQKEy0ssP9HACKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" itemprop="image" src="https://1.bp.blogspot.com/-LPnQa6hDJ3M/Vy97KiOcDrI/AAAAAAAByhw/FHxtvHbRrfU1AdAC9JvycRQKEy0ssP9HACKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_3.jpg" /></a></div>
<br />
There is some interactivity involved with "Allumette." While it is very minor, there is a point or two where you can actually move around within the story and open up different views, not just different angles of the same thing. Virtual reality gives you that kind of true 3D experience, which is a lot different than what we usually think of as 3D film, with things flying at the screen and so forth. I can't review "Allumette" yet, because I haven't yet seen it. You have to wear one of those obnoxious headsets, or perhaps just big glasses, which is a downer. Anyway, the details will sort themselves out. I am just giving a head's up that something new is coming down the road, and you may be interested when it gets here. I sure am.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://4.bp.blogspot.com/-ErN15f8r39g/Vy97LdV3DII/AAAAAAAByh0/kKrm3tkifowg9OZbgraHIv1y0RXevEzHgCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_2.PNG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Allumette animatedfilmreviews.filminspector.com Penrose Studios" border="0" itemprop="image" src="https://4.bp.blogspot.com/-ErN15f8r39g/Vy97LdV3DII/AAAAAAAByh0/kKrm3tkifowg9OZbgraHIv1y0RXevEzHgCKgB/s1600/Allumette_3D_animatedfilmreviews.filminspector.com_2.PNG" /></a></div>
<br />
So, I'm not sure what to think about this yet. I like the entire concept of a marriage between virtual reality and animation. I don't particularly like the bulky VR viewers that you have to strap to your head and the fact that it could make a lot of people nauseous. With "Allumette," the medium is the message, as the famous saying goes. I'm not interested in the story, which I'm sure is very pleasing and novel, but in the technique. Unfortunately, pictures cannot do this justice. Let's just say you'll have to see this to believe it, so if you are into animation, you may want to make that a priority at some point. Unfortunately, we all still have to wait for it.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/Aa1LcTiA_2Q" width="640"></iframe></center>
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-28134396069586386582016-02-29T07:59:00.003-07:002020-03-08T22:54:47.601-06:00Inside Out and Bear Story Win Oscars<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-mMm0AeDSoIU/VtRZ6AjTIHI/AAAAAAABv4s/Ko0rBNXMQ4s/s1600/Oscars.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Oscars animatedfilmreviews.filiminspector.com" border="0" itemprop="image" src="https://1.bp.blogspot.com/-mMm0AeDSoIU/VtRZ6AjTIHI/AAAAAAABv4s/Ko0rBNXMQ4s/s1600/Oscars.jpg" title="" /></a></div>
<br />
To absolutely nobody's surprise, Walt Disney Pictures' "<b itemprop="name">Inside Out</b>" won the Oscar for a best-animated feature film. There was absolutely no suspense to the award whatsoever. To be frank, this was a weak year for animated feature films, with no "Ratatouille" in view, let alone a "Frozen." I can think of several great animated films of recent years, such as, oh, "Wreck-It Ralph" for example, that were more enduring than "Inside Out." In a weak year, though, the big-study favorite invariably wins. It was a safe choice and was deserved. Kids love it. Congratulations to the winners, superb execution.<br />
<br />
"Bear Story" won for best short, which was a minor (but welcome) surprise. Well-deserved, but a surprise considering that it was up against a Pixar film. The animation was indifferent by modern standards (which are quite tough to stand out from), but the story was told well and the tale touched the heart <i>if you let it</i> (the bear works through sadness and regret and marches on). Really, that is what film - not just animation - is all about. It also is something that I personally found lacking in "Inside Out" despite its brilliant technical execution.<br />
<br />
I personally like the choice of "Bear Story," which required some actual thought and originality from the Academy members. It was a nice recognition of the wide range of animation today throughout this great big world.<br />
<br />
The official synopsis for "Bear Story" (Historia de un Oso) states:<br />
<blockquote class="tr_bq">
"Every day, a melancholy old bear takes a mechanical diorama that he has created out to his street corner. For a coin, passersby can look into the peephole of his invention, which tells the story of a circus bear who longs to escape and return to the family from which he was taken."</blockquote>
"Bear Story" was made by Gabriel Osorio and Pato Escala at Punkrobot Studio. In my preview of the Oscars, I went on and on about how my sentimental choice would be a win from one of the foreign efforts, and Bear Story - from Chile - fits the bill nicely (financed in part by the Chilean government).<br />
<br />
Well done, Academy!<br />
<br />
"Inside Out" also was up for a Writing (Original Screenplay) Oscar. It did not win. This did not surprise me at all. The whole concept behind "Inside Out" is a hoary cliché that goes back over 40 years when Woody Allen did an extended riff on it. It was fresh then, not so much now. In this case, the true honor really was to be nominated.<br />
<h2>
ANIMATED FEATURE FILM</h2>
<i>Anomalisa</i><br />
<br />
<i>Boy and the World</i><br />
<br />
<span style="font-size: large;">Inside Out - WINNER</span><br />
<br />
<i>Shaun the Sheep Movie</i><br />
<br />
<i>When Marnie Was There</i><br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://1.bp.blogspot.com/-YFshpo-re1A/VtRbl34kg3I/AAAAAAABv44/pTZhbB64418/s1600/Bear_Story.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt=""Bear Story" animatedfilmreviews.filiminspector.com" border="0" itemprop="image" src="https://1.bp.blogspot.com/-YFshpo-re1A/VtRbl34kg3I/AAAAAAABv44/pTZhbB64418/s1600/Bear_Story.jpg" title="" /></a></div>
<br />
<h2>
SHORT FILM (ANIMATED)</h2>
<br />
<span style="font-size: large;">Bear Story - WINNER</span><br />
<br />
<i>Prologue</i><br />
<i><br /></i>
<i>Sanjay’s Super Team</i><br />
<i><br /></i>
<i>We Can’t Live Without Cosmos</i><br />
<i><br /></i>
<i>World of Tomorrow</i><br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="https://2.bp.blogspot.com/-TpcUdkz8NOM/VtRZ5gwFYpI/AAAAAAABv4o/hejFTfB2L3k/s1600/Snow_White_Oscars_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Walt Disney with his Oscars animatedfilmreviews.filiminspector.com" border="0" itemprop="image" src="https://2.bp.blogspot.com/-TpcUdkz8NOM/VtRZ5gwFYpI/AAAAAAABv4o/hejFTfB2L3k/s1600/Snow_White_Oscars_2.jpg" title="" /></a></div>
<br />
<span class="updated">2020</span></div>
<br /></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-71951179533813931432016-01-14T15:58:00.000-07:002020-03-08T22:52:20.484-06:002016 Animated Oscar Nominations<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://2.bp.blogspot.com/-cbWyPo4YiCg/VpCyofFq-4I/AAAAAAABs-k/jOsGfghBATc/s1600/Oscars.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="2016 Oscars animatedfilmrevews.filminspector.com" border="0" itemprop="image" src="https://2.bp.blogspot.com/-cbWyPo4YiCg/VpCyofFq-4I/AAAAAAABs-k/jOsGfghBATc/s1600/Oscars.jpg" title="" /></a></div>
<div class="separator" style="clear: both; text-align: center;">
<br /></div>
"<a href="http://animatedfilmreviews.filminspector.com/2014/11/big-hero-6-2014-marshmallow-man-to.html" target="_blank">Big Hero 6</a>" from Disney won the Animated Feature Film in 2015. This year's field is a relatively weak one. Pixar's "<a href="http://animatedfilmreviews.filminspector.com/2015/07/inside-out-2015-pixar-back-in-action.html" target="_blank">Inside Out</a>" is a favorite for that Oscar in 2016. The Animated Short Film field does not have a clear favorite, but Pixar also has an entry there - "Sanjay's Super Team" - and that will be a strong contender.<br />
<br />
The 88th Academy Awards ceremony will take place on 28 February 2016 at 7 p.m. EST.<br />
<br />
My personal picks - meaning the ones I think will win - are "Inside Out" for Animated Feature Film and "Sanjay's Super Team" for Animated Short Film. Yes, another good year for Disney. Its quality is just too great to mess with these days.<br />
<br />
My sentimental picks - meaning what I wish would win - are "Boy and the World" and "Bear Story." This is just because of the odds against them even being made - in South America! - and nominated were so great. The animation is in great shape south of the border, but nobody can compete with the Disney machine on even terms. Richard Williams is just phenomenal and kudos to his nomination so many decades after "A Christmas Carol," I love it when the legends return for another bow.<br />
<br />
The biggest injustice was "The Peanuts Movie" being snubbed, but I admit that it was kind of just what you would expect from a, well, "Peanuts" movie. With that exception, I think the nominations were appropriate. Several foreign-made films ("Boy and the World," "Shaun the Sheep Movie," and "When Marnie Was There") were nominated, illustrating the health of the global animation industry.<br />
<br />
<b>ANIMATED SHORT FILM</b><br />
<br />
<b>Bear Story</b><br />
<i>dir. Gabriel Osorio, pro. Pato Escala</i><br />
<b>Prologue</b><br />
<i>dir. Richard Williams, pro. Imogen Sutton</i><br />
<b>Sanjay’s Super Team</b><br />
<i>dir. Sanjay Patel, pro. Nicole Grindle</i><br />
<b>We Can’t Live Without Cosmos</b><br />
<i>dir. Konstantin Bronzit</i><br />
<b>World of Tomorrow</b><br />
<i>dir. Don Hertzfeldt</i><br />
<br />
<b>ANIMATED FEATURE FILM</b><br />
<br />
<b>Anomalisa</b><br />
<i>dir. Charlie Kaufman and Duke Johnson, pro. Rosa Tran</i><br />
<b>Boy and the World</b><br />
<i>dir. Alê Abreu</i><br />
<b>Inside Out</b><br />
<i>dir. Pete Docter, pro. Jonas Rivera</i><br />
<b>Shaun the Sheep Movie</b><br />
<i>dir. Mark Burton and Richard Starzak</i><br />
<b>When Marnie Was There</b><br />
<i>dir. Hiromasa Yonebayashi, pro. Yoshiaki Nishimura</i><br />
<br />
As widely expected, "Inside Out" also nabbed a nomination for Best Original Screenplay.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-VdCpLx8e968/VpCyn0a0hXI/AAAAAAABs-g/1ZREwXgaUg8/s1600/Snow_White_Oscars_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Walt Disney Oscars animatedfilmrevews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-VdCpLx8e968/VpCyn0a0hXI/AAAAAAABs-g/1ZREwXgaUg8/s1600/Snow_White_Oscars_2.jpg" title="" /></a></div>
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-35016069027434917402015-11-26T07:15:00.001-07:002020-03-08T23:49:59.726-06:00Einstein's Theory of Relativity - Animated<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://4.bp.blogspot.com/-UwHCQZpeVRs/VlcS-PUHTYI/AAAAAAABqtI/cis3-g1r_jo/s1600/Einstein_theory_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Albert Einstein theory of relativity animatedfilmreviews.filminspector.com" border="0" height="284" itemprop="image" src="https://4.bp.blogspot.com/-UwHCQZpeVRs/VlcS-PUHTYI/AAAAAAABqtI/cis3-g1r_jo/s320/Einstein_theory_1.JPG" title="Space-time-matter." width="320" /></a></div>
<br />
<b itemprop="name">Einstein's Theory of Relativity - Animated</b><br />
<br />
And now for something completely different.<br />
<br />
One of those never-noted but significant dates in history is 25 November 1915. Aside from some fighting during World War I, this was the date that Albert Einstein published his General Theory of Relativity.<br />
<br />
Einstein's theory is still difficult to understand. This animation aims to make is simple.<br />
<br />
A lot of talent went into this. It was animated by award-winning animator Eoin Duffy, who worked with filmmaker Jamie Lochhead. That voice you hear may sound familiar - it is the star of Doctor Who, David Tennant. Some of the basic science was supplied by science communicator Anais Rassat. And all in three minutes!<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="450" mozallowfullscreen="" src="https://player.vimeo.com/video/146869349" webkitallowfullscreen="" width="800"></iframe> <a href="https://vimeo.com/146869349">#Einstein100 - General Relativity</a> from <a href="https://vimeo.com/eoinduffy">Eoin Duffy</a> on <a href="https://vimeo.com/">Vimeo</a>.</center>
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-b7hmIFa9F7E/VlcS-JcDVrI/AAAAAAABqtM/UPY_TO1C-qA/s1600/Einstein_theory_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Albert Einstein theory of relativity animatedfilmreviews.filminspector.com" border="0" height="253" itemprop="image" src="https://3.bp.blogspot.com/-b7hmIFa9F7E/VlcS-JcDVrI/AAAAAAABqtM/UPY_TO1C-qA/s320/Einstein_theory_2.JPG" title="" width="320" /></a></div>
<br />
A short film celebrating the centennial of Einstein's theory of General Relativity.<br />
<br />
JAMIE LOCHHEAD - Writer / Producer<br />
EOIN DUFFY - Design / Animation<br />
DAVID TENNANT - Narrator<br />
WESLEY SLOVER - Sound Design<br />
ANAÏS RASSAT Writer / Science Outreach / Communication<br />
A WINDFALL FILMS production for the SCIENCE & TECHNOLOGY FACILITIES COUNCIL<br />
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-63228025128324186302015-11-21T04:56:00.001-07:002020-03-08T22:49:05.669-06:00Shortlist for 2016 Animated Feature Film Oscar<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-0Y4j6RcE0gk/VlBZC2xjvlI/AAAAAAABqlA/1i5tXM7sm_Q/s1600/Oscars.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Oscars animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-0Y4j6RcE0gk/VlBZC2xjvlI/AAAAAAABqlA/1i5tXM7sm_Q/s1600/Oscars.jpg" title="" /></a></div>
<br />
It is time to start thinking about the <b itemprop="name">2016 Oscar for Best Animated Feature Film</b>.<br />
<br />
The 88th Academy Awards are coming up, and the process already is underway to find out the winners - even though 2015 still has over a month to go, and several contenders haven't even been released yet.<br />
<br />
It is impossible to handicap this race at this time, but some guesses are in order. "<a href="http://animatedfilmreviews.filminspector.com/2014/11/shaun-sheep-movie-trailer-2.html" target="_blank">Shaun the Sheep Movie</a>" is my own sentimental pick, and "Minions" is so popular ($1.15 billion) that it is one of the favorites, along with "The Good Dinosaur" (not yet released, but sure to be a holiday hit). I was not impressed by "<a href="http://animatedfilmreviews.filminspector.com/2015/07/inside-out-2015-pixar-back-in-action.html" target="_blank">Inside Out</a>," but it also will get a lot of consideration simply due to how much money it made ($840 million). After that, "<a href="http://animatedfilmreviews.filminspector.com/2014/10/kahlil-gibrans-prophet-magical.html" target="_blank">Kahlil Gibran’s The Prophet</a>" is my choice for a dark horse slot, though nobody saw it.<br />
<br />
Five films out of these 16 will be nominated.<br />
<br />
The submitted features, listed in alphabetical order, are:<br />
<br />
Anomalisa<br />
The Boy And The Beast<br />
Boy And The World<br />
The Good Dinosaur<br />
Home<br />
Hotel Transylvania 2<br />
Inside Out<br />
Kahlil Gibran’s The Prophet<br />
The Laws Of The Universe – Part 0<br />
Minions<br />
Moomins On The Riviera<br />
The Peanuts Movie<br />
Regular Show: The Movie<br />
Shaun The Sheep Movie<br />
The SpongeBob Movie: Sponge Out Of Water<br />
When Marnie Was There<br />
<br />
The Oscar nominations will be announced on January 14, with the Oscars telecast set for February 28 on ABC hosted by Chris Rock.<br />
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-80363984924436839002015-11-21T04:24:00.000-07:002020-03-08T22:47:48.260-06:00Oscar Shortlist 2016 Best Animated Short Film<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://1.bp.blogspot.com/-NV2wbblYoZA/VlBQlmmZ79I/AAAAAAABqks/bRMnfB7GxWE/s1600/Oscars.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Oscars animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://1.bp.blogspot.com/-NV2wbblYoZA/VlBQlmmZ79I/AAAAAAABqks/bRMnfB7GxWE/s1600/Oscars.jpg" title="" /></a></div>
<br />
Below is the shortlist for the <b itemprop="name">2016 Oscar for Best Animated Short Film</b>.<br />
<br />
The 88th Academy Awards nominations will be announced on January 14, 2016, and the 88th Oscars will take place on February 28, 2016. The process of selecting films is already in motion. The second round of voting commences on 30 December 2015, and the results will be announced on 14 January with other nominees.<br />
<br />
While there is no clear favorite, any entry by Pixar such as "Sanjay's Super Team" is likely to get serious consideration. There are two National Film Board of Canada entries, and it always does well, too.<br />
<br />
Five films will make the next cut.<br />
<br />
The shortlisted animated short films:<br />
<ul style="text-align: left;">
<li>“Bear Story (Historia De Un Oso),” Gabriel Osorio, director, and Pato Escala, producer (Punkrobot Animation Studio) </li>
<li>“Carface (Autos Portraits),” Claude Cloutier, director (National Film Board of Canada) </li>
<li>“If I Was God…,” Cordell Barker, director (National Film Board of Canada) </li>
<li>“Love in the Time of March Madness,” Melissa Johnson and Robertino Zambrano, directors (High Hip Productions and KAPWA Studioworks) </li>
<li>“My Home,” Phuong Mai Nguyen, director (Papy3D Productions)</li>
<li>“An Object at Rest,” Seth Boyden, director (California Institute of the Arts) </li>
<li>“Prologue,” Richard Williams, director, and Imogen Sutton, producer (Animation Masterclass) </li>
<li>“Sanjay’s Super Team,” Sanjay Patel, director, and Nicole Grindle, producer (Pixar Animation Studios) </li>
<li>“We Can’t Live without Cosmos,” Konstantin Bronzit, director (Melnitsa Animation Studio) </li>
<li>“World of Tomorrow,” Don Hertzfeldt, director (Bitter Films)</li>
</ul>
The 10 shortlisted films for Best Animated Short Film were chosen by members of the Academy’s Short Films and Feature Animation Branch from among 60 qualifying films.<br />
<br />
Disney is by far the leader in wins in the category, and the company has won two of the last three years, with “Paperman” in 2013 and “Feast” earlier this year. It does not have an entry in the race this year for the first time in several years.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://2.bp.blogspot.com/-mokcm6koKvg/VlBQlVlkw8I/AAAAAAABqko/P-i7M_QR6Zs/s1600/Walt%2BDisney%2B12%2Bwith%2Bawards.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" itemprop="image" src="https://2.bp.blogspot.com/-mokcm6koKvg/VlBQlVlkw8I/AAAAAAABqko/P-i7M_QR6Zs/s1600/Walt%2BDisney%2B12%2Bwith%2Bawards.jpg" /></a></div>
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-37229620291143643272015-11-17T04:41:00.004-07:002020-03-09T00:06:15.601-06:00Un Gallo Con Muchos Huevos (2015): A Surprise Mexican Hit<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://4.bp.blogspot.com/-t-gC6NjRDNs/VksHAmz-uxI/AAAAAAABqUM/VSVL4ej04Ek/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_1.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://4.bp.blogspot.com/-t-gC6NjRDNs/VksHAmz-uxI/AAAAAAABqUM/VSVL4ej04Ek/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_1.jpg" title="" width="640" /></a></div>
<br />
Mexico is often overlooked as a source of animation, though I have <a href="http://animatedfilmreviews.filminspector.com/2014/10/dia-de-muertos-animation.html" target="_blank">written</a> about it once or twice before. There are no borders when it comes to animation; it just requires skill, dedication, and creativity. Released in early September <span itemprop="dateCreated">2015</span>, <span itemprop="description">a satirical CG-animated film from Mexico</span> titled "<b itemprop="name">Un Gallo Con Muchos Huevos</b>" ("A Rooster With A Lot Of Eggs") became a surprise hit at the U.S. box office.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://4.bp.blogspot.com/-rZ4E_iwVxi8/VksHBB1Y-LI/AAAAAAABqUU/k9y2B_9KEKM/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_2.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://4.bp.blogspot.com/-rZ4E_iwVxi8/VksHBB1Y-LI/AAAAAAABqUU/k9y2B_9KEKM/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_2.jpg" title="" width="640" /></a></div>
<br />
As reported on 14 September 2015, the <span itemprop="genre">3D animated feature film in Spanish</span> film opened in 10th place in the U.S. with a domestic gross of $4.8 million. To date, two months later, it has <a href="http://www.boxofficemojo.com/movies/?id=ungalloconmuchoshuevos.htm" target="_blank">grossed</a> over $9 million in the States and an unreported amount - probably a lot - elsewhere, including Mexico and Spain. Not too shabby for a film most Americans had no idea existed. The total was earned at only about 400 U.S. cinemas nationwide, too, which makes the size of its surprise hit even more unusual. In fact, it is the first Mexican animated feature to open in the United States with a limited theatrical release and is paving the way for others.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://4.bp.blogspot.com/-ab84Q-PMSWE/VksHA9Uz1iI/AAAAAAABqUQ/Reln2c52GOQ/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_3.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://4.bp.blogspot.com/-ab84Q-PMSWE/VksHA9Uz1iI/AAAAAAABqUQ/Reln2c52GOQ/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_3.jpg" title="" width="640" /></a></div>
<br />
The film was produced for about $5.3 million and distributed by Pantelion, a partnership between Lionsgate Entertainment and Grupo Televisa. It already is a financial success. It was a smash hit in Mexico, where it opened on 21 August and held the top spot at the box office for three weeks. Additional international releases are scheduled for Russia, Europe, and Latin American.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://1.bp.blogspot.com/-ULBE_Ft0xis/VksHBVevz5I/AAAAAAABqUY/YY5vEtqvErU/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_4.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://1.bp.blogspot.com/-ULBE_Ft0xis/VksHBVevz5I/AAAAAAABqUY/YY5vEtqvErU/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_4.jpg" title="" width="640" /></a></div>
<br />
It really shouldn't have come as much of a surprise, though. The property has a relatively long history in Mexico, where it is quite popular. The marketing there includes a successful website, merchandising and a pair of 2D animated features. In fact, its origins are from the website, not vice versa, which makes the entire process even more unusual. The site, "Huevocartoon," was created by brothers <span itemprop="director" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Rodolfo and Gabriel Riva Palacio</span></span> — who wrote, directed and produced "Un Gallo" — as a satirical site somewhat similar to The Onion. The uniqueness came from portraying the satire in the form of eggs. Just as in America, "Huevos" has the slang meaning of "balls," and you can conclude for yourself why a satirical website would choose that particular image, and why the titular character might have a lot of them.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://4.bp.blogspot.com/-SUT5SgrAYAU/VksOSQoARrI/AAAAAAABqVQ/ry4aKUXJsrQ/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_8.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://4.bp.blogspot.com/-SUT5SgrAYAU/VksOSQoARrI/AAAAAAABqVQ/ry4aKUXJsrQ/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_8.jpg" title="" width="640" /></a></div>
<br />
The first cartoon appeared in 2002, and it was an immediate success. As Rodolfo has said:<br />
<blockquote class="tr_bq">
“We were expecting to have around 6,000 visitors in the first six months, but what happened is that immediately everybody loved the idea of making a society with eggs and we had around 3 million visitors to our website in just two months, which was crazy!”</blockquote>
The brothers quickly formed a company, <span itemprop="productionCompany">Huevocartoon Productions</span>, to put out a successful line of merchandise.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-cs8t0ASd4Sg/VksHCL1Mv8I/AAAAAAABqUg/0grnMzdTSRU/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_5.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://3.bp.blogspot.com/-cs8t0ASd4Sg/VksHCL1Mv8I/AAAAAAABqUg/0grnMzdTSRU/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_5.jpg" title="" width="640" /></a></div>
<br />
Videocine, a division of Televisa, approached Huevocartoon about doing a standard 2D animated movie. "Una Pelicula de Huevos" ("A Movie about Eggs") came out in 2006, followed in 2009 by "Otra Película de Huevos y un Pollo" ("Another Movie about a Chicken and Eggs"). Both were hits in Mexico — Riva Palacio says the first movie was the second-highest-grossing Mexican film of all time when it was released. Its success was exceeded by the sequel.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://1.bp.blogspot.com/-E8mxE_YjbJg/VksHCGhUOII/AAAAAAABqUk/Yc2N8GUc7bc/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_6.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://1.bp.blogspot.com/-E8mxE_YjbJg/VksHCGhUOII/AAAAAAABqUk/Yc2N8GUc7bc/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_6.jpg" title="" width="640" /></a></div>
<br />
The release of the first two films was limited to Spanish-speaking markets. The next step was to go global. Videocine, Pantelion and the government provided funding to make the project a possibility. The brothers had to learn how to do CGI, and then production took about 2½ years and involved 120 artists. Much of that time went into developing the story. The expense was always an issue, so the company developed its own software.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://2.bp.blogspot.com/-Dc9nAnmVeWA/VksMvIdAefI/AAAAAAABqVE/Qf_wQ6eh_eo/s1600/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_7.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Un Gallo Con Muchos Huevos animatedfeaturefilms.filminspector.com" border="0" height="360" itemprop="image" src="https://2.bp.blogspot.com/-Dc9nAnmVeWA/VksMvIdAefI/AAAAAAABqVE/Qf_wQ6eh_eo/s640/Un_Gallo_Con_Muchos_Huevos_animatedfilmreviews.filminspector.com_7.jpg" title="" width="640" /></a></div>
<br />
The talent is primarily from Mexico, where there is growing interest in animation, though the brothers themselves studied in the U.S. Pantelion was formed by Televisa and Lionsgate in 2010. It was a new direction for Lionsgate, which does not have much animation experience and is more known for its teen dramas like "<a href="http://movieloversreviews.filminspector.com/2013/01/thehungergames.html" target="_blank">The Hunger Games</a>" and "<a href="http://movieloversreviews.filminspector.com/2014/03/divergent-stills.html" target="_blank">Divergent</a>." The brothers’ relationship with Televisa and its Videocine division opened the door for the deal with Pantelion. The film was targeted at Spanish-speaking markets in the United States due to cost factors. However, there is an English-language version of the movie that likely will get a home-video release. And, yes, there is a sequel on the way.<br />
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-41567221142252597262015-11-07T01:19:00.001-07:002020-03-08T22:44:31.635-06:00Dragons: Race to the Edge<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/TVSeries">
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="http://4.bp.blogspot.com/-iV3r0ajM8_U/Vj2yTWqOIEI/AAAAAAABqFA/0beGEvuOYhM/s1600/Dragons_race_to_the_edge_1.JPG" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Dragons Race to the Edge animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://4.bp.blogspot.com/-iV3r0ajM8_U/Vj2yTWqOIEI/AAAAAAABqFA/0beGEvuOYhM/s1600/Dragons_race_to_the_edge_1.JPG" title="" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">"Dragons: Race to the Edge."</td></tr>
</tbody></table>
"<b itemprop="name">Dragons: Race to the Edge</b>" is a prequel to "<a href="http://animatedfilmreviews.filminspector.com/2012/11/how-to-train-your-dragon-2010-moments.html" target="_blank">How To Train Your Dragon</a>." More adventures from Hiccup, Toothless and the Dragon Riders. The series, from DreamWorks Animation and Netflix, stars the voices of Jay Baruchel, America Ferrera, and Zach Pearlman.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/N7Xor_F2A0M" width="640"></iframe></center>
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-51349439751219030182015-11-07T01:04:00.003-07:002020-03-08T22:38:08.819-06:00"Kung Fu Panda 3" coming on January 29, 2016<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/TVSeries">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://1.bp.blogspot.com/-q3CZQlRzzJQ/Vj2uiXuSaqI/AAAAAAABqE0/NxLeWQW_kXM/s1600/Kung_Fu_Panda_3_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="Kung Fu Panda 3 animatedfilmrevies.filminspector.com" border="0" itemprop="image" src="https://1.bp.blogspot.com/-q3CZQlRzzJQ/Vj2uiXuSaqI/AAAAAAABqE0/NxLeWQW_kXM/s1600/Kung_Fu_Panda_3_1.JPG" title="" /></a></div>
<br />
"<b itemprop="name">Kung Fu Panda 3</b>" is directed by Jennifer Yuh and Alessandro Carloni, and the English voice cast stars <span itemprop="actor" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Jack Black</span></span>, <span itemprop="actor" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Angelina Jolie</span></span>, <span itemprop="actor" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Dustin Hoffman</span></span>, J.K. Simmons, Seth Rogen, David Cross, Jackie Chan, and Lucy Liu. It follows the continuing adventures of Po, voiced by Black, who is an unassuming hero. The film opens simultaneously on January 20, 2016, in China and the US.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/10r9ozshGVE" width="640"></iframe></center>
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/fGPPfZIvtCw" width="640"></iframe></center>
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/-g42ci-cmBA" width="640"></iframe></center>
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-11675529514151685772015-11-07T00:45:00.000-07:002020-03-08T22:35:50.236-06:00"DinoTrux," A Great Netflix Animated Series<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/tvseries">
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="http://3.bp.blogspot.com/-ILZg_2hZttY/Vj2oDeYZkeI/AAAAAAABqEY/MI8btPnVKYs/s1600/Dinotrux_trailer.JPG" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Dinotrux animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-ILZg_2hZttY/Vj2oDeYZkeI/AAAAAAABqEY/MI8btPnVKYs/s1600/Dinotrux_trailer.JPG" title="" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">"Dinotrux."</td></tr>
</tbody></table>
"<b itemprop="name">DinoTrux</b>" now is available from Netflix. It is a popular digital series from DreamWorks Animation.<br />
<br />
From the DreamWorksTV <a href="http://www.dreamworkstv.com/shows/dinotrux/" target="_blank">website</a>:<br />
<blockquote class="tr_bq">
<b>Welcome to a world of giant creatures that are half dinosaur, half construction vehicle and all awesome in DREAMWORKS DINOTRUX! Meet Ty Rux, a massive Tyrannosaurus Trux, and his best friend Revvit, a razor-sharp Reptool. Together, the Dinotrux and Reptools join forces for the first time ever to build a bigger, better world and battle back against the biggest and baddest of them all: D-Structs, who threatens to wreck everything they’ve built.</b></blockquote>
<div>
Each DinoTrux episode is only five minutes long. It doesn't take much to bore kids, so these are bite-sized episodes designed for little kids who may get antsy. The show is on <a href="https://www.netflix.com/title/80049903" target="_blank">Netflix</a>.</div>
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/IOhkyu5ZZ2s" width="640"></iframe></center>
<br />
The cast includes Ty-Rux (Andrew Francis), a friendly T-Trux (combination Tyrannosaurus Rex and megaton excavator); D-Structs (Paul Dobson), a ruthless T-Trux who doesn't like nosy visitors; Revvit (Richard Ian Cox), a miniature "reptool" who is good at fixing things; Skya (Ashleigh Bell), a combination brachiosaur and crane; Ton-Ton (Matt Hill), an Ankylosaurus dump truck; and Dozer (Brian Drummond), a Triceratops-bulldozer with an attitude who must learn to get along. It is from the book by Chris Gall.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/osIHyvbABOY" width="640"></iframe></center>
<br />
DinoTrux toys, incidentally, should be available at Toys 'R' Us.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-fDRK6rB7Xug/Vj2oDdCI3AI/AAAAAAABqEc/4uuR3ikAgh8/s1600/Dinotrux_book_cover.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Dinotrux animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-fDRK6rB7Xug/Vj2oDdCI3AI/AAAAAAABqEc/4uuR3ikAgh8/s1600/Dinotrux_book_cover.jpg" title="" /></a></div>
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-54548001254963967512015-10-26T18:28:00.002-06:002020-03-08T22:33:02.017-06:00Global Cooling Animation<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://2.bp.blogspot.com/-c3fTbY3bUzw/Vi7E0KK9fmI/AAAAAAABpqI/yHv8xPZTnL4/s1600/Cooling_environment.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="cooling animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://2.bp.blogspot.com/-c3fTbY3bUzw/Vi7E0KK9fmI/AAAAAAABpqI/yHv8xPZTnL4/s1600/Cooling_environment.jpg" title="" /></a></div>
<br />
Let's face it, you don't hear much about global cooling these days, right? This clever animation is both informative and cautionary. It is well worth watching by anyone interested in the environment.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="315" src="https://embed.theguardian.com/embed/video/environment/video/2015/oct/26/keeping-cool-making-us-hot-video-animation-climate-change" width="560"></iframe></center>
<br />
I think that you will agree that the animation's conclusions are unassailable.<br />
<br />
<span class="updated">2020</span></div>
<br /></div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-49307390301450984052015-10-25T18:05:00.001-06:002020-03-08T22:32:03.905-06:00"Strange Alloy" - The Future, Buddhist Style<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="http://3.bp.blogspot.com/--vrc0dC4KBk/Vi1px84LzuI/AAAAAAABpis/Sil7PqqCZEM/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_4.JPG" imageanchor="1" style="margin-left: auto; margin-right: auto; text-align: center;"><img alt="Strange Alloy animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/--vrc0dC4KBk/Vi1px84LzuI/AAAAAAABpis/Sil7PqqCZEM/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_4.JPG" title="" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">"Strange Alloy."</td></tr>
</tbody></table>
"<b itemprop="name">Strange Alloy</b>" (<span itemprop="dateCreated">2015</span>) is an odd short film that is both beautiful and philosophical. It was created in two months by director <span itemprop="director" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Loïc Bramoullé</span></span>. It has great animation, but I just want to add - and I don't usually say this about shorts - but it has a great sound. Just because it is odd, incidentally, doesn't mean that I don't like it. I do.<br />
<br />
"Strange Alloy" is just unusual.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-WxmR0nNaIa8/Vi1pxYJ_oII/AAAAAAABpio/qFlUVTDmApY/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_2.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Strange Alloy animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-WxmR0nNaIa8/Vi1pxYJ_oII/AAAAAAABpio/qFlUVTDmApY/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_2.JPG" title="" /></a></div>
<br />
The landscapes are from Myanmar. Bramoullé did the animation work back in his Paris studio.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="450" mozallowfullscreen="" src="https://player.vimeo.com/video/140719975?color=fcdb92&badge=0" webkitallowfullscreen="" width="800"></iframe> <a href="https://vimeo.com/140719975">Strange alloy - indy very short film</a> from <a href="https://vimeo.com/liok">liok</a> on <a href="https://vimeo.com/">Vimeo</a>.</center>
<br />
<span itemprop="description">The script is about the future, but the conclusion is based on Buddhist philosophies.</span> Now, just how often do you get to view a <span itemprop="genre">sci-fi animation</span> with a Buddist slant? I didn't think so. And, before you find that too odd or alien to a bother with - it is not heavy-handed. It simply asks a question with an answer that is both obvious and indisputable.<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-NCxjgHUey6A/Vi1pxaVQd_I/AAAAAAABpik/tfDHToBTVHM/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_3.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Strange Alloy animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-NCxjgHUey6A/Vi1pxaVQd_I/AAAAAAABpik/tfDHToBTVHM/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_3.JPG" title="" /></a></div>
<br />
The film also is odd because Bramoullé released a "making of" a film about "Strange Alloy" that is longer than the film itself. If you like animation, it is worth watching, but sometimes the mystery of animation is best left behind the scenes. Your call.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="450" mozallowfullscreen="" src="https://player.vimeo.com/video/137428089" webkitallowfullscreen="" width="800"></iframe> <a href="https://vimeo.com/137428089">Strange alloy: making of</a> from <a href="https://vimeo.com/liok">liok</a> on <a href="https://vimeo.com/">Vimeo</a>.</center>
<br />
I like to give exposure to good animated works and their creators, especially if they are of fine quality but unlikely to reach a wide audience. I only post films that I think are worth your time. Hope you enjoyed it.<br />
<br />
Original music by <span itemprop="contributor" itemscope="" itemtype="http://schema.org/Person"><span itemprop="name">Thomas Barrandon</span></span> (soundcloud.com/thomasbarrandon)<br />
Mix & sound design by Resonant Step (resonantstep.com)<br />
Alien voice (sound design) by Morgan Hammel (morganhamel@gmail.com)<br />
Creature design, sculpt, surfacing: Loïc Bramoullé<br />
Rig: Vincent Donaz, Daniel Quintero<br />
Animation: Vincent Donaz, Daniel Quintero, Benoit Vincent, Aurélie Vigneron<br />
tracking, lighting, rendering: Rachad Meya, Loïc Bramoullé<br />
Color grading, compositing: Vivien Ebran, Loïc Bramoullé<br />
Matte paintings: Loïc bramoullé<br />
Cloth simulation: Caroline Lobato<br />
Particules & flares: Niels Prayer<br />
Produced with the support of SupaRésidence ©<br />
<br />
<div class="separator" style="clear: both; text-align: center;">
<a href="http://3.bp.blogspot.com/-7QEyjM8T8WM/Vi1pxSlACDI/AAAAAAABpig/TcxrmoT5wQU/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_1.JPG" imageanchor="1" style="margin-left: 1em; margin-right: 1em; text-align: center;"><img alt="Strange Alloy animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-7QEyjM8T8WM/Vi1pxSlACDI/AAAAAAABpig/TcxrmoT5wQU/s1600/Strange_Alloy_animatedfilmreviews.filminspector.com_1.JPG" title="" /></a></div>
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-65787748433459392312015-10-22T18:26:00.001-06:002020-03-08T22:27:41.152-06:00Watch A Star Entering A Black Hole<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="http://1.bp.blogspot.com/-qsNH2Ac94AI/Vil8OKZiK9I/AAAAAAABpXU/I5eXRR2FilQ/s1600/Black_holes_NASA_3.JPG" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="star black hole NASA animatedfilmreviews.filminspector.com" border="0" height="389" itemprop="image" src="https://1.bp.blogspot.com/-qsNH2Ac94AI/Vil8OKZiK9I/AAAAAAABpXU/I5eXRR2FilQ/s640/Black_holes_NASA_3.JPG" title="" width="640" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Black Hole.</td></tr>
</tbody></table>
Watch A Star Entering A Black Hole.<br />
<br />
<center>
<iframe allowfullscreen="" frameborder="0" height="315" src="https://embed.theguardian.com/embed/video/science/video/2015/oct/22/star-enters-a-black-hole-nasa-video-animation" width="560"></iframe></center>
<br />
NASA is more into animation these days than it is into manned space flight. If it weren't for the ISS, that would be pretty much all NASA does in that regard - animation.<br />
<br />
Fortunately, the animators are not earthbound. Here is a clever <b itemprop="name">animation of a star being drawn into the gravity of a black hole</b>. First, intense tidal forces rip the star apart, flinging stellar debris outward at high speed. Then, the greatest mass of the star descends towards the black hole, causing a flare.<br />
<br />
These types of videos kind of lose their impact due to the scale of our screens. Seeing some little thing gobble up some other little thing is not inherently impressive. However, for those into these things like me, just imagine the sun that you see overhead on clear summer days somehow coming afoul of one of these things. That stable star that keeps the entire solar system alive would get ripped apart like the one in this video. And it wouldn't take too long, either.<br />
<br />
Source: Nasa Goddard.<br />
<br />
<span class="updated">2020</span></div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-43329551993572912902015-10-17T12:33:00.005-06:002020-03-08T22:25:18.561-06:00Monty Python And The Holy Grail: Lost Footage<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Movie">
<table align="center" cellpadding="0" cellspacing="0" class="tr-caption-container" style="margin-left: auto; margin-right: auto; text-align: center;"><tbody>
<tr><td style="text-align: center;"><a href="http://3.bp.blogspot.com/-bsXfMXUXp84/ViKR7P06KMI/AAAAAAABo-E/Cb3bLB8gVMA/s1600/terry_gilliam.jpg" imageanchor="1" style="margin-left: auto; margin-right: auto;"><img alt="Terry Gilliam Monty Python and The Holy Grail animatedfilmrevews.filminspector.com" border="0" itemprop="image" src="https://3.bp.blogspot.com/-bsXfMXUXp84/ViKR7P06KMI/AAAAAAABo-E/Cb3bLB8gVMA/s1600/terry_gilliam.jpg" title="" /></a></td></tr>
<tr><td class="tr-caption" style="text-align: center;">Terry Gilliam.</td></tr>
</tbody></table>
Terry Gilliam, who did the animation for Monty Python, narrates some lost footage from the original "<b itemprop="name">Monty Python & The Holy Grail</b>." It's interesting to fans for several reasons:<br />
<ol style="text-align: left;">
<li>It's lost footage!</li>
<li>Some of the footage is quite good!</li>
<li>Some of it isn't, but it's lost footage!</li>
<li>Terry Gilliam talks!</li>
<li>Terry Gilliam talks good!</li>
<li>Terry Gilliam gives some insight into his animation process!</li>
<li>Terry Gilliam talks!</li>
</ol>
Okay, it helps if you are a fan. But some of the footage is right up there with what made it into the film. He's an amusing chap, and really does show you how and why it was done.<br />
<br />
This is all in service of some 40th-anniversary products which, if you're a fan, you know all about anyway, and if you aren't, well, you couldn't care less anyway. If you miss this chance, don't worry, you'll get another chance to buy something from them in ten years for the 50th anniversary.<br />
<br />
<center>
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/AGl4P1sokwI" width="640"></iframe></center>
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0tag:blogger.com,1999:blog-3476622805364190755.post-36158339413844090382015-10-14T19:27:00.001-06:002020-03-08T22:23:28.814-06:00MH17 Shoot-Down Animation<div dir="ltr" style="text-align: left;" trbidi="on">
<div itemscope="" itemtype="http://schema.org/Thing">
<div class="separator" style="clear: both; text-align: center;">
<a href="http://1.bp.blogspot.com/-_Q-_utdDvdQ/Vh77tJypbwI/AAAAAAABo64/T5m-Ao-P1jY/s1600/MH370.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img alt="MH17 Malaysian Airlines animatedfilmreviews.filminspector.com" border="0" itemprop="image" src="https://1.bp.blogspot.com/-_Q-_utdDvdQ/Vh77tJypbwI/AAAAAAABo64/T5m-Ao-P1jY/s1600/MH370.jpg" title="MH17 wreckage." /></a></div>
<br />
MH17 Shoot-Down Animation.<br />
<br />
<iframe allow="accelerometer; autoplay; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="360" src="https://www.youtube.com/embed/EbOkDg_hqow" width="640"></iframe><br />
<br />
<b itemprop="name">Malaysia Airlines flight 17</b> crashed on July 17, 2014, in Eastern Ukraine. That is an area in which Russian separatists have been fighting Ukrainian government authorities. Speculation ever since has been that it was shot down by a surface-to-air missile of some kind, most likely by the separatists. Another theory is that whoever shot the missile thought that it was a plane carrying Vladimir Putin, who indeed was aboard another flight that day.<br />
<br />
The Dutch Safety Board has been running the investigation because most of the 298 passengers on board were of Dutch nationality. It has concluded that a missile shot down the plane. It has released an animation of the crash that assumes a “path of the missile” that it is assumed downed the plane. It is important to remember that this is all hypothetical, and just because there is a very smooth animation, does not make it fact. Basically, there are three versions to this incident: the Ukrainian version, the Russian version, and this version.<br />
<br />
According to the report, a Buk surface-to-air missile exploded less than a meter from the cockpit of the Malaysian Airlines flight. That killed the crew instantly. The front of the plane then broke off, and the rest of the plane had no chance.<br />
<br />
While there is broad agreement about some aspects of the incident, some details of the investigation are disputed.<br />
<br />
The official probe into the crash has found that the crash could have been avoided. The airspace should have been closed due to the danger in the area.<br />
<br />
The report did not conclude who fired the missile, which is of great political significance and unknowable from the wreckage alone. Instead, it only examined what actually happened, and where. It identified a 320-square kilometer area where the assumed missile launch most likely took place. That area, according to many sources, was under rebel separatist (<u>i.e.</u>, Russian) control at the time of the crash, but that is disputed. Additionally, the report contends that the missile most likely was launched from a particular village named Zaroshchenskoe.<br />
<br />
The Russians dispute only part of this. They claim that that village was under Ukrainian government control at the time, not Russian separatists. In July, Russia vetoed a UN security council resolution to establish an international criminal tribunal to investigate the airliner’s destruction. They called it politically motivated.<br />
<br />
<span class="updated">2020</span>
</div>
</div>
Unknownnoreply@blogger.com0