The Animators Had Some Fun with "Frozen"
There are all sorts of hidden treats in "Frozen." Let's take a look, one by one. We'll try to give a little background to each, just skip over those parts if they bore you.
Mickey Mouse
There's an old-time Disney character who makes his way into "Frozen" who doesn't appear in a lot of films these days.![Mickey Mouse makes an appearance in "Frozen." Anna Frozen Mickey Mouse animatedfilmreviews.filminspector.com](https://blogger.googleusercontent.com/img/b/R29vZ2xl/AVvXsEhPceitgNBUyFQV596AOYvrjrr4PfkW6YCYF-gUsRu_-_mL-S6D-neWk1PBfUdZgktNmG6GtPIBujx6nZo1vT50fj7wzo25onXAWQe8R85fB2pfFlk_ym3-mDZS1M5oRCcaYndNFAv_I88/s1600/frozen-mickey.jpg)
Look closely when Anna (Kristen Bell) ventures into Wandering Oaken's Trading Post and Sauna. If you look very closely, you might spot Mickey Mouse hiding out down there. It is dark and he is hard to see except on a big screen, but Mickey is definitely there.
"The Swing"
![]() |
Lisa Keene's copy of "The Swing," before putting in the "Frozen" character (bottom) and after (above). |
![]() |
"I won!" |
![]() |
Concept art for Rapunzel, apparently by Keene |
"Tangled" also makes an even more direct appearance in "Frozen" elsewhere, but we'll get to that below.
Thus, there's a huge, hidden connection between "Tangled" and "Frozen," two of Disney's best recent films.
![]() |
Fragonard's "The Swing." |
As background, Jean-Honoré Fragonard was a French painter and printmaker who lived from 1732 to 1806 in Paris. The man worked like a madman, painting some 550 quality paintings during the final years of the French Monarchy. "The Swing" is one of his more interesting paintings because it shows a man pushing a lady on a swing while another man, hidden from the guy pushing the lady, is watching the lady fly up into the air. It is pretty clear that the hidden fellow is looking up the lady's dress, but she doesn't care, perhaps because they are having an affair and the first fellow - boyfriend/husband/whatever - is clueless. That may explain why she looks so happy. This kind of ribaldry was frowned upon in serious paintings back in the day, but Fragonard earned a good commission for it anyway. I mean, it's a good painting, and I'm not just saying that because it's old and respected. Fragonard clearly was pushing the limits with "The Swing" during that puritanical age, but Keene managed to tone it back down again.
Eugene and Rapunzel from "Tangled"
![]() |
Eugene and Rapunzel? |
Nothing is there by accident.
Below is a reference to another recent Disney classic.
"Wreck-It Ralph" Reference
![]() |
Chocolate! |
Anybody who saw "Wreck-It Ralph" and was looking for insider stuff instantly would have recognized the tasty treats that Anna likes so much.
Below is the introduction of the racers in the "Sugar Rush" game in "Wreck-It Ralph" for comparison.
Donny Osmond
Now we come to one of the most subtle references you'll ever find in a Disney movie (and actually find out about). There supposedly is a Donny Osmond reference in "Frozen." For real!![]() |
Donny Osmond in the 1970s, Hans in "Frozen." |
This isn't a very good way to see it, but it is from this scene:
![]() |
The "Love is an Open Door" scene. |
Well, because the animator in charge of that sequence was his nephew.
Hyrum Osmond (now there's a name you don't hear every day) has been at Disney since 2008's "Bolt." On "Frozen," Hyrum was the supervising animator for Olaf, the lovable snowman. However, he stepped in to animate Prince Hans for that one particular moment.
According to Yahoo Movies, Osmond said, "I requested that shot, just because I knew that that was the perfect moment to kind of pepper in that Donny Osmond feel to it."
![]() |
There really isn't much of a resemblance between Hans and Donny, and nobody would have known if Hyrum didn't spill the beans. It is more about Hans' mannerisms while singing than his look. |
Hyrum is the son of George Virl Osmond Jr., the eldest of Donny's seven brothers. George isn't very well known because he never sang with the Osmonds due to hearing impairment. He was always around, though, just as much a part of the family as anyone else.
Further quoting Hyrum:
Obviously we were exposed to the 'Donny and Marie' show. We were on set a lot. And me and my brothers and sisters almost playfully mocked our uncles with their signature move, which was basically sort of a tilted head, eyes squinting, with the raising of their arm or arms as they belt out that note. I just thought it was a perfect moment to kind of hit the Donny Osmond pose there.So take that for what it's worth. It hardly seemed worth asking permission to put in, because, well, you can barely see it even after you are told it is there. But, that is Hyrum's nod to uncle Donny. It pays to be nice to your nephews.
Crazy End Credits
Now, there's one more that isn't that well known. It's not, however, an easter egg, but rather a crazy credit. But it's amusing, and nice to see it and be able to tell your friends about it.![]() |
Crazy Credits. |
This one reads:
The views and opinions expressed by Kristoff in the film that all men eat their own boogers are solely his own and do not necessarily reflect the views and opinions of The Walt Disney Company or the filmmakers.So there you go, the animators had their fun, and almost nobody noticed!
Reference to "Arrested Development"
Anna and Hans have a cute exchange about finishing each others' ... sandwiches. This happens to be a direct homage to a similar scene in the Fox television show "Arrested Development." The Fox show aired from 2003 - 2006, but then had a revival in 2013. Since that was the same year that "Frozen" was released, it likely wasn't an accident. Disney always tosses in a few obscure references like this for the truly observant!
---------------------------------------------
You also might be interested in my full review of "Frozen."
You may find the "Let It Go" sequence from "Frozen" here. It includes a wonderful performance by a 9-year-old singing it - the film version is there at the bottom of the page, animation included. There's a fun lip-synch to "Love is an Open Door" here.
I also have collections of still pictures from "Frozen" as a supplement to my review here and here.
Learn some unknown facts about Elsa here.
2020
any chance of knowing the names of other paintings in Frozen shown prior to "The Swing"?
ReplyDeleteI am very young and I saw the end credit where it talks about kristoff. I told all my family and almost the entire theatre they all laughed.
ReplyDeleteGlad you enjoyed it, Abbigal, that's what it's all about. :)
ReplyDeleteJames, another obsure easter egg is the 4 main character names being a reference to someone important when said quickly enough. I'll let you reaserch the rest though :) AND as an added bonus the references name is creditted in the end credits :)
ReplyDeleteFor those who can't figure it out: Hans, Kristoff, Anna, Sven-- Hans Christian Andersen.
Delete(this is a different anon by the way)