Tuesday, December 2, 2014

Annie Award Nominations Announced

Annie Awards animatedfilmreviews.filminspector.com

The International Animated Film Society, ASIFA-Hollywood, has announced the nominations for its 42nd Annual Annie Awards. The Annies recognize the year’s best in the field of animation.

The Annie Awards were created in 1972 by veteran voice talent June Foray. While not at the status level of the Oscars or even the Golden Globes, the Annie Awards are eagerly sought by those in the industry because they only choose among animation projects.

There are eight films nominated for Best Animated Feature. There are no real surprises, the only semi-surprise would be the inclusion of  'Cheatin',' but it probably has no chance against the big studios (now watch me be proven wrong). This category is pretty much the only one that people outside the industry notice:

  • Big Hero 6 (Walt Disney Animation Studios), 
  • Cheatin’ (Plymptoons Studio), 
  • How to Train Your Dragon 2 (DreamWorks Animation SKG), 
  • Song of the Sea (Cartoon Saloon/GKIDS), 
  • The Book of Life (Reel FX), 
  • The Boxtrolls (Laika/Focus Features), 
  • The LEGO Movie (Warner Bros. Pictures),  
  • The Tale of The Princess Kaguya (Studio Ghibli/GKIDS).

Otherwise, the nominations are not too surprising. Someone dropping in from Mars and having missed the last twelve months might be slightly surprised at how poorly some highly touted sequels did - 'Rio 2' and 'Penguins of Madagascar' spring to mind, for instance - and also at the weak showing overall by DreamWorks Animation. However, that effect is pretty subtle, because the DreamWorks banner was upheld nicely by 'How to Train Your Dragon 2.' That one mildly underperforming sequel (by some measures) makes their year appear to be a lot better than it really was with disasters such as 'Mr. Peabody & Sherman' and what already appears to be a weak showing from 'Penguins' as well.

'The Lego Movie' nabbed a top nomination, but otherwise the nominators were unimpressed. In terms of the shorts, the voting looks to narrow down between 'Coda' and 'Feast,' with 'Coda' the quality favorite but 'Feast' benefitting from the Disney machine (though that didn't help its short entry last year). 'Duet' is a fantastic short, but doesn't seem to have grabbed the Zeitgest this year.

Otherwise, the year is wide open, at least as compared to 2013 (with 'Frozen') and 2012 (with the weak but pc-favorite 'Brave.') This may be in large part due to the fact that Pixar did not release any films in 2014, since their releases often dominate the awards season.

Favorites? Look for 'Big Hero 6' and 'Coda' to eek out wins. But 'Big Hero 6' is a very, very weak favorite; while Disney hasn't said it is underperforming, the lack of positive headlines about it since its release speaks volumes. While not a disappointment, 'Hero' is not a game-changing world-beater like 'Frozen,' either - but then, what is? 'Coda,' a huge fan favorite, suffers from being a foreign entry, but it has enough support to mount at the very least a strong challenge to whoever wins. The Irish should be smiling.

The winners will be announced at a black tie ceremony on Saturday, January 31st, 2015 at UCLA’s Royce Hall at 7:00 pm.

Annie Awards animatedfilmreviews.filminspector.com
'Frozen' was the big winner last year

The Annies are recognizing video game animation more and more, which is a nice bow toward the real world. Video game animation is in many ways the cutting edge of the entire field, with all due respect to CGI and its constant development (which, incidentally, is almost as old as the Annies themselves if you go all the way back to 'Westworld').

According to ASIFA-Hollywood Executive Director, Frank Gladstone:
“We had a steady increase in submissions this year and I am excited to say it’s going to be a great awards ceremony. We added a new category to the mix – Best Character Animation in a Video Game – bringing the total Annie categories (including Juried awards) to 36. The Annies are a true celebration of the best talent in the animation industry, from big studio features to indie films, television series to internet shows, games, shorts and student films alike, as well as a wonderful group of juried award recipients again this year.”

Annie Awards animatedfilmreviews.filminspector.com

#1 Best Animated Feature

Big Hero 6

Walt Disney Animation Studios


Plymptoons Studio

How to Train Your Dragon 2

DreamWorks Animation

Song of the Sea

GKIDS/Cartoon Saloon

The Book of Life

Reel FX

The Boxtrolls

Focus Features/Laika

The LEGO Movie

Warner Bros. Pictures

The Tale of The Princess Kaguya

GKIDS/Studio Ghibli

#2 Best Animated Special Production

Cosmos: A Spacetime Odyssey

Voyager Pictures LLC

Dawn of the Dragon Racers

DreamWorks Animation

How Murray Saved Christmas

Universal Television


Bent Image Lab

Toy Story That Time Forgot

Pixar Animation Studios

#3 Best Animated Short Subject


62 George Street


Glen Keane Productions


Walt Disney Animation Studios

Inside Homer - The Simpsons Couch Gag (Episode #549)

Acme Filmworks

Me and My Moulton

National Film Board of Canada


Moonbot/Dolby (Creative Artists Agency)

The Dam Keeper

Tonko House LLC

The Raven 

Moonbot Studios

#4 Best Animated Television/Broadcast Commercial

Citizen M: "Swan Song"

Stoopid Buddy Stoodios

Flight of the Stories

Aardman Animations

LEGO Batman 3: Beyond Gotham

Plastic Wax

#5 Best Animated Television/Broadcast Production For Preschool Children

Doc McStuffins

Disney Channel / Disney XD

Peter Rabbit

Nickelodeon Animation Studio

Tumble Leaf

Amazon Studios


Nickelodeon Animation Studio

Zack & Quack

Zodiak Kids

#6 Best Animated Television/Broadcast Production For a Children's Audience

Adventure Time

Cartoon Network

Gravity Falls

Disney Television Animation

Legend of Korra

Nickelodeon Animation Studio

Over The Garden Wall

Cartoon Network

Wander Over Yonder

Disney Television Animation

#7 Best General Audience Animated Television/Broadcast Production


FX Networks

Back To Backspace

Cartoon Network Studios

Bob's Burgers

Bento Box Entertainment

Rick and Morty

Starburns Industries, Inc.

Mike Tyson Mysteries

Warner Bros. Animation

Regular Show

Cartoon Network Studios

The Simpsons

#8 Best Video Game

Forza Horizon 2

Microsoft - Turn 10 Studios

Valiant Hearts: The Great War


Child of Light


#9 Best Student Film

After School

Junyi Xiao

Dead Over Heels

Jose Matheu

El Coyote

Javier Barboza

Frog's Legs

Katie Tamboer

My Big Brother

Jason Rayner

Tiny Nomad

Toniko Pantoja

Achievement Categories

#10 Outstanding Achievement for Animated Effects in an Animated Production

Big Hero 6

Walt Disney Animation Studios

Michael Kaschalk, Peter DeMund, David Hutchins, Henrik Falt, John Kosnik

How to Train Your Dragon 2

DreamWorks Animation

James Jackson, Lucas Janin, Tobin Jones, Baptiste Van Opstal, Jason Mayer

Mr. Peabody & Sherman

DreamWorks Animation

Fangwei Lee, Krzysztof Rost, Jihyun Yoon, Robert Chen

Penguins of Madagascar

DreamWorks Animation

Mitul Patel, Nicolas Delbecq, Santosh Khedkar, Yash Argawal

The Book of Life

Reel FX

Augusto Schillaci, Erich Turner, Bill Konersman, Chris Rasch, Joseph Burnette

The Boxtrolls

Focus Features/Laika

Rick Sevy, Peter Vickery, Kent Estep, Peter Stuart, Ralph Procida

The LEGO Movie

Warner Bros. Pictures

Jayandera Danappal, Matt Ebb, Christian Epunan Hernandez, Danielle Brooks, Raphael Gadot

#11 Outstanding Achievement for Animated Effects in a Live Action Production

Edge of Tomorrow

Sony Pictures Imageworks

Steve Avoujageli, Atsushi Ikarashi, Pawel Grochola, Paul Waggoner, Viktor Lundqvist


Industrial Light & Magic

Raul Essig, Karin Cooper, Rick Hankins, Owen Calouro

The Amazing Spider-Man 2

Sony Pictures Imageworks

Charles-Felix Chabert, Daniel La Chapelle, Spencer Lueders, Klaus Seitschek, Chris Messineo

The Hobbit: The Desolation of Smaug

Weta Digital

Areito Echevarria, Andreas Soderstrom, Ronnie Menahem, Christoph Sprenger, Kevin Romond

Transformers: Age of Extinction

Industrial Light & Magic

Michael Balog, Jim Van Allen, Rick Hankins, John Hansen

X-Men: Days of Future Past

Digital Domain

Jeremy Hampton, Daniel Stern, Edmond Smith III, Hiroshi Tsubokawa, Daniel Jenkins

#12 Outstanding Achievement for Character Animation in an Animated Television / Broadcast Production

Toy Story That Time Forgot

Pixar Animation Studios

Don Crum

Toy Story That Time Forgot

Pixar Animation Studios

Carlo Vogele

Toy Story That Time Forgot

Pixar Animation Studios

Ken Kim

Tumble Leaf

Amazon Studios

Michael Granberry

Tumble Leaf

Amazon Studios

Teresa Drilling

Wander Over Yonder

Disney Television Animation

Justin Nichols

#13 Outstanding Achievement for Character Animation in an Animated Feature Production

How to Train Your Dragon 2

DreamWorks Animation

Fabio Lignini

How to Train Your Dragon 2

DreamWorks Animation

Steven "Shaggy" Hornby

How to Train Your Dragon 2

DreamWorks Animation

Thomas Grummt

Penguins of Madagascar

DreamWorks Animation

Ravi Kamble

The Boxtrolls

Focus Features/Laika

Travis Knight

The Boxtrolls

Focus Features/Laika

Malcolm Lamont

The Boxtrolls

Focus Features

Jason Stalman

#14 Outstanding Achievement for Character Animation in a Live Action Production

Dawn of the Planet of the Apes

Weta Digital

Daniel Barrett, Paul Story, Eteuati Tema, Alessandro Bonora, Dejan Momcilovic

Guardians of the Galaxy


Kevin Spruce, Dale Newton, Sidney Kombo, Chris Mullins, Brad Silby

The Hobbit: The Desolation of Smaug

Weta Digital

Eric Reynolds, David Clayton, Andreja Vuckovic, Guillaume Francois, Gios Johnston

#15 Outstanding Achievement for Character Animation in a Video Game

Assassin's Creed Unity


Mike Mennillo

Don't Starve: Console Edition

Klei Entertainment Inc.

Child Of Light


Alex Drouin

#16 Outstanding Achievement for Character Design in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Andy Suriano

Wander Over Yonder

Disney Television Animation

Benjamin Balistreri

Welcome to the Wayne

Nickelodeon Animation Studio

Zac Gorman

#17 Outstanding Achievement for Character Design in an Animated Feature Production

Big Hero 6

Walt Disney Animation Studios

Shiyoon Kim, Jin Kim

Mr. Peabody & Sherman

DreamWorks Animation

Timothy Lamb, Joe Moshier

Penguins of Madagascar

DreamWorks Animation

Craig Kellman, Joe Moshier, Stevie Lewis, Todd Kurosawa

Rio 2

Blue Sky Studios

Sang Jun Lee, Jason Sadler, José Manuel Fernandez Oli

Song of the Sea

GKIDS/Cartoon Saloon

Tomm Moore, Marie Thorhauge, Sandra Anderson, Rosa Ballester Cabo

The Book of Life

Reel FX

Paul Sullivan, Sandra Equihua, Jorge R. Gutierrez

The Boxtrolls

Focus Features/Laika

Mike Smith

#18 Outstanding Achievement for Directing in an Animated Television / Broadcast Production

Adventure Time

Cartoon Network

Yuasa Masaaki, Eunyoung Choi


FX Networks

Bryan Fordney

Bob's Burgers

Bento Box Entertainment

Jennifer Coyle & Bernard Derriman

Disney Mickey Mouse

Disney Television Animation

Aaron Springer

Gravity Falls

Disney Television Animation

Rob Renzetti

Over The Garden Wall

Cartoon Network

Robert Alvarez, Ken Bruce, Larry Leichliter

The Simpsons

The Simpsons

Matthew Nastuk

Wander Over Yonder

Disney Television Animation

David Thomas

#19 Outstanding Achievement for Directing in an Animated Feature Production

Big Hero 6

Walt Disney Animation Studios

Don Hall & Chris Williams


Plymptoons Studio

Bill Plympton

How to Train Your Dragon 2

DreamWorks Animation

Dean DeBlois

Song of the Sea

GKIDS/Cartoon Saloon

Tomm Moore

The Book of Life

Reel FX

Jorge R. Gutierrez

The Boxtrolls

Focus Features/Laika

Anthony Stacchi & Graham Annable

The LEGO Movie

Warner Bros. Pictures

Phil Lord & Christopher Miller, Directors; Chris McKay, Co-Director

The Tale of The Princess Kaguya

GKIDS/Studio Ghibli

Isao Takahata

#20 Outstanding Achievement for Music in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Christopher Willis

Dora and Friends: Into the City!

Nickelodeon Animation Studio

Peter Lurye, George Gabriel, Chris Gifford

Lego Ninjago: Masters of Spinjitzu


Jay Vincent, Michael Kramer, Jeppe Riddervold, Erin Chapman

Marvel's Avengers Assemble

Dynamic Music Partners

Lolita Ritmanis, Kristopher Carter & Michael McCuistion

Tumble Leaf

Amazon Studios

Nathan Barr & Lisbeth Scott

#21 Outstanding Achievement for Music in an Animated Feature Production


Plymptoons Studio

Nicole Renaud, Composer

How to Train Your Dragon 2

DreamWorks Animation

John Powell, Jónsi

Mr. Peabody & Sherman

DreamWorks Animation

Danny Elfman

Song of the Sea

GKIDS/Cartoon Saloon

Bruno Coulais & Kila

The Tale of The Princess Kaguya

GKIDS/Studio Ghibli

Joe Hisaishi

#22 Outstanding Achievement for Production Design in an Animated Television / Broadcast Production

Cosmos: A Spacetime Odyssey

Voyager Pictures LLC

Kara Vallow, Brent Woods, Lucas Gray & Andrew Brandou

Disney Mickey Mouse

Disney Television Animation

Joseph Holt

Mickey Shorts


Narina Sokolova

The Powerpuff Girls

Cartoon Network

Kevin Dart, Chris Turnham, Jasmin Lai & Elle Michalka

Turbo FAST

DreamWorks Animation

Antonio Canobbio, Khang Le, Mark Taihei, Howard Chen & Brandon Cuellar

Wander Over Yonder

Disney Television Animation

Alex Kirwan, Chris Tsirigotis, Alexander Duckworth, Janice Kubo & Francis Giglio

Zack & Quack

Zodiak Kids

Erez Gavish

#23 Outstanding Achievement for Production Design in an Animated Feature Production

Mr. Peabody & Sherman

DreamWorks Animation

David James, Ruben Perez, Priscilla Wong, Timothy Lamb & Alexandre Puvilland

Song of the Sea

GKIDS/Cartoon Saloon

Adrien Merigeau

The Book of Life

Reel FX

Simon Varela & Paul Sullivan

The Boxtrolls

Focus Features/Laika

Paul Lasaine, Tom McClure & August Hall

The LEGO Movie

Warner Bros. Pictures

Grant Freckelton

#24 Outstanding Achievement for Storyboarding in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Heiko Drengenberg

Gravity Falls

Disney Television Animation

Luke Weber, Alonso Ramirez Ramos, Neil Graf & Steve Heneveld

Legend of Korra

Nickelodeon Animation Studio

Joaquim Dos Santos

Star Wars Rebels

Disney Channel / Disney XD

Nathaniel Villanueva & Douglas Lovelace

The Simpsons

Film Roman

Brad Ableson, Matthew Faughnan & Stephen Reis

Toy Story That Time Forgot

Pixar Animation Studios

Louise Smythe

Wander Over Yonder

Disney Television Animation

Mark Ackland

#25 Outstanding Achievement for Storyboarding in an Animated Feature Production

Big Hero 6

Walt Disney Animation Studios

Marc E. Smith

How to Train Your Dragon 2

DreamWorks Animation

Truong "Tron" Son Mai

Planes: Fire & Rescue

Disneytoon Studios

Piero Peluso

Rio 2

Blue Sky Studios

John Hurst

Rio 2

Blue Sky Studios

Rodrigo Castro

The Boxtrolls

Focus Features

Julian Nariño

The Boxtrolls

Focus Features/Laika

Emanuela Cozzi

#26 Outstanding Achievement for Voice Acting in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Bill Farmer as the voices of Goofy and Grandma

Fairly Oddparents

Nickelodeon Animation Studio

Carlos Alazaraqui as the voice of Crocker

Robot Chicken

Stoopid Buddy Stoodios

Seth Green as the voice of Robot Chicken Nerd

#27 Outstanding Achievement for Voice Acting in an Animated Feature Production

Henry & Me

Reveal Animation Studios

Cyndi Lauper as the voice of Nurse Cyndi

Rio 2

Blue Sky Studios

Andy Garcia as the voice of Eduardo

The Boxtrolls

Focus Features/Laika

Sir Ben Kingsley as the voice of Archibald Snatcher

The Boxtrolls

Focus Features/Laika

Dee Bradley Baker as the voice of Fish

#28 Outstanding Achievement for Writing in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Darrick Bachman

The Powerpuff Girls

Cartoon Network

Dave Tennant, David P. Smith, Chris Mitchell & Will Mata

The Simpsons

20th Century Fox

Rob LaZebnik

The Simpsons

20th Century Fox

Tim Long

Toy Story That Time Forgot

Pixar Animation Studios

Steve Purcell

#29 Outstanding Achievement for Writing in an Animated Feature Production

Big Hero 6

Walt Disney Animation Studios

Robert L. Baird, Daniel Gerson & Jordan Roberts

How to Train Your Dragon 2

DreamWorks Animation

Dean DeBlois

Song of the Sea

GKIDS/Cartoon Saloon

Will Collins

The Boxtrolls

Focus Features/Laika

Irena Brignull & Adam Pava

The Lego Movie

Warner Bros. Pictures

Phil Lord & Christopher Miller

#30 Outstanding Achievement for Editorial in an Animated Television / Broadcast Production

Disney Mickey Mouse

Disney Television Animation

Illya Owens

Dragons: Defenders of Berk

DreamWorks Animation Television

Ernesto Matamoros

Family Guy

Super 78

Mike Elias

Toy Story That Time Forgot

Pixar Animation Studios

David Suther, Bradley Furnish & David Condolora

Turbo FAST

DreamWorks Animation

Todd Raleigh & Doug Vito

#31 Outstanding Achievement for Editorial in an Animated Feature Production

Big Hero 6

Walt Disney Animation Studios

Tim Mertens

How to Train Your Dragon 2

DreamWorks Animation

John K. Carr

Planes: Fire & Rescue

Disneytoon Studios

Dan Molina, Mark Keefer & Karen Hathaway

Song of the Sea

GKIDS/Cartoon Saloon

Darragh Byrne

The LEGO Movie

Warner Bros. Pictures

David Burrows, Todd Hansen, Doug Nicholas, Jonathan Tappin & Courtney O'Brien-Brown

Juried Awards

The Winsor McCay Award - For Lifetime Achievement

Didier Brunner, Don Lusk and Lee Mendelson

The June Foray Award - for significant and benevolent or charitable impact on the art and industry of animation

Charles Solomon

The Ub Iwerks Award – for technical advancement that has made a significant impact on the art or industry of animation

DreamWorks Animation's Apollo Software

Special Achievement Award - recognizing the unique and significant impact on the art and industry of animation.

The Walt Disney Family Museum


No comments:

Post a Comment