The Animators Had Some Fun with "Frozen"
![]() |
Chocolate! |
Hidden Images in "Frozen"
There are all sorts of hidden treats in "Frozen." Let's take a look, one by one. We'll also try to give a little background.Mickey Mouse
There's an old-time Disney character who makes his way into "Frozen" who doesn't appear in a lot of films these days.
Look closely when Anna (Kristen Bell) ventures into Wandering Oaken's Trading Post and Sauna. If you look very closely, you might spot Mickey Mouse hiding out down there. Hard to see except on a big screen.
"The Swing"
![]() |
Lisa Keene's copy of "The Swing," before putting in the "Frozen" character (bottom) and after (above). |
![]() |
Keene's concept art for Rapunzel. |
![]() |
"And 'Frozen' wins the Academy Award!" |
"Tangled" also makes an even more direct appearance in "Frozen" elsewhere, but we'll get to that below.
Thus, there's a huge, hidden connection between "Tangled" and "Frozen," two of Disney's best recent films.
![]() |
Fragonard's "The Swing." |
As background, Jean-Honoré Fragonard was a French painter and printmaker who lived from 1732 to 1806 in Paris. The man worked like a madman, painting some 550 quality paintings during the final years of the French Monarchy. "The Swing" is one of his more interesting paintings because it shows a man pushing a lady on a swing while another man, hidden from the guy pushing the lady, is watching the lady fly up into the air. It is pretty clear that the hidden fellow is looking up the lady's dress, but she doesn't care, perhaps because they are having an affair and the first fellow - boyfriend/husband/whatever - is clueless. That may explain why she looks so happy. This kind of ribaldry was frowned upon in serious paintings back in the day, but Fragonard earned a good commission for it anyway. I mean, it's a good painting, and I'm not just saying that because it's old and respected. But he was pushing the limits with this during that puritanical age.
Eugene and Rapunzel
![]() |
Eugene and Rapunzel? |
Nothing is there by accident.
Below is a reference to another recent Disney classic.
Wreck-It Ralph
The fairly obvious reference to "Wreck-It Ralph" probably got noticed by a few people, though it wasn't exactly emphasized. People usually don't go into films watching for clues to previous films, but some do because they know there are usually things slipped in by animators on the sly. Some of those easter eggs have been intentional, some have been misinterpreted (clouds forming the word sex?), some have been put in maliciously by disgruntled animators (phallic symbols in ornate castle designs) - but there's usually something. And sometimes Disney just re-uses old material - they were still using work done for "Sleeping Beauty" decades later, and some of the designs for "The Little Mermaid" derived from unused treatments from the 1930s. So, there's usually something there for those with a sharp eye, especially in the "prestige" projects like "Frozen."
Anybody who saw "Wreck-It Ralph" and was looking for insider stuff instantly would have recognized the tasty treats that Anna likes so much.
Below is the introduction of the racers in the "Sugar Rush" game in "Wreck-It Ralph" for comparison.
Donny Osmond
Now we come to one of the most subtle references you'll ever find in a Disney movie (and actually find out about). There supposedly is a Donny Osmond reference in "Frozen." For real!![]() |
Donny Osmond in the 1970s, Hans in 'Frozen' |
This isn't a very good way to see it, but it is from this scene:
![]() |
The "Love is an Open Door" scene |
Well, because the animator in charge of that sequence was his nephew.
Hyrum Osmond (now there's a name you don't hear every day) has been at Disney since 2008's "Bolt." On "Frozen," Hyrum was the supervising animator for Olaf, the lovable snowman. However, he stepped in to animate Prince Hans for that one particular moment.
According to Yahoo Movies, Osmond said, "I requested that shot, just because I knew that that was the perfect moment to kind of pepper in that Donny Osmond feel to it."
![]() |
There really isn't much of a resemblance, and nobody would have known if Hyrum didn't spill the beans |
Hyrum's is the son of George Virl Osmond Jr., the eldest of Donny's seven brothers. George isn't very well known because he never sang with the Osmonds due to hearing impairment. He was always around, though, just as much a part of the family as anyone else.
Further quoting from Yahoo:
"Obviously we were exposed to the 'Donny and Marie' show. We were on set a lot. And me and my brothers and sisters almost playfully mocked our uncles with their signature move, which was basically sort of a tilted head, eyes squinting, with the raising of their arm or arms as they belt out that note. I just thought it was a perfect moment to kind of hit the Donny Osmond pose there."So take that for what it's worth. It hardly seemed worth asking permission to put in, because, well, you can barely see it even after you are told it is there. But, that is Hyrum's nod to uncle Donny. It pays to be nice to your nephews.
Crazy End Credits
Now, there's one more that isn't that well known. It's not, however, an easter egg, but rather a crazy credit. But it's amusing, and nice to see it and be able to tell your friends about it.![]() |
Crazy Credits! |
This one reads:
”The views and opinions expressed by Kristoff in the film that all men eat their own boogers are solely his own and do not necessarily reflect the views and opinions of The Walt Disney Company or the filmmakers.”So there you go, the animators had their fun, and almost nobody noticed!
Reference to "Arrested Development"
Anna and Hans have a cute exchange about finishing each others' ... sandwiches. This happens to be a direct homage to a similar scene in the Fox television show "Arrested Development." The Fox show aired from 2003 - 2006, but then had a revival in 2013. Since that was the same year that "Frozen" was released, it likely wasn't an accident. Disney always tosses in a few obscure references like this for the truly observant!
---------------------------------------------
You also might be interested in my full review of "Frozen."
You may find the "Let It Go" sequence from "Frozen" here. It includes a wonderful performance by a 9-year-old singing it - the film version is there at the bottom of the page, animation included. There's a fun lip-synch to "Love is an Open Door" here.
I also have collections of still pictures from "Frozen" as a supplement to my review here and here.
Little-Known Facts about Elsa
![]() |
Elsa |
![]() |
Broadway actress Idina Menzel voices and sings Elsa, including "Let It Go." |
However, even the most ardent fan of "Frozen" may not know all that there is to know about Anna's big sister. Here are nine facts about Elsa and how she relates to the other Disney princesses that you may not know.
![]() |
Elsa. |
2. The character is very loosely based on the titular character in Hans Christian Andersen's fairy tale "The Snow Queen." While The Snow Queen was completely evil and the main character of the original tale, that is not the case in "Frozen." Officially, Elsa is not the antagonist but rather what is known as a deuteragonist. That's the second most important character in a story. In "Frozen," Anna gets the most attention and is the protagonist or central character. While Elsa may be the most exciting character, she is not the one who goes searching for her sister, that is Anna.
![]() |
Princess Grace of Monaco. |
4. Elsa's look completely changed during the making of "Frozen." Originally, she was going to have dark hair before becoming The Snow Queen, to give her a punk look. The hair would have been short and fierce. Ultimately, they decided that was the wrong look for Elsa.
![]() |
Elsa and Anna at the Walt Disney World Christmas Parade in 2013 |
6. The Technical Directors at Disney had to create entirely new software to accurately show Elsa's famous braid. It's not nearly as simple as they made it look, and since it is her signature hairdo (like Merida's in "Brave"), it had to be just right.
![]() |
Disney Princesses. |
8. While it may seem as though many Disney Princesses have special powers, that is not the case. In fact, Elsa is only the second Disney princess to have special powers: Rapunzel was the first.
9. Elsa is only the second Princess in the Disney universe to not have any love interest. Even Anna finds love! That may be because Elsa has to lock herself away in her own castle and nobody comes to visit. How sad! In fact, she is only the second princess to not find love, the first being Merida. Maybe she will find someone in the sequel? Here's hoping!
2020
No comments:
Post a Comment