Monday, October 13, 2014

"Toy Story of Terror" Airing Wednesday October 15 2014

Toy Story of Terror! Tom Hanks Tim Allen animatedfilmreviews.filminspector.com


ABC brought together the "Toy Story" cast last year and premiered "Toy Story of Terror!" To nobody's surprise, it turns out that it is going to be an annual showing, sort of along the the lines of "It's The Great Pumpkin Charlie Brown."

It airs again on Wednesday, October 15 2014 on ABC 8 EST.

Toy Story of Terror! Tom Hanks Tim Allen animatedfilmreviews.filminspector.com



Thursday, October 09, 2014
ABC Television Network
PRESS RELEASE - PRESS RELEASE - -
"TOY STORY OF TERROR!," DISNEY•PIXAR'S FIRST SPECIAL FOR TELEVISION AIRS WEDNESDAY, OCTOBER 15
Print This Document
note: To use this function, upgrade your browser: Quick Download

“TOY STORY OF TERROR!,” DISNEYPIXAR’S FIRST SPECIAL FOR TELEVISION FEATURING A SPOOKY NEW TALE WITH ALL OF YOUR FAVORITE CHARACTERS
FROM THE “TOY STORY” FILMS,” TO AIR WEDNESDAY, OCTOBER 15 ON ABC

Tom Hanks and Tim Allen Reprise Their Roles as Woody and Buzz


DisneyPixar’s first special for television, “Toy Story OF TERROR!,” a spooky tale featuring all of your favorite characters from the “Toy Story” films, airs WEDNESDAY, OCTOBER 15 (8:00-8:30 p.m., ET). (Rebroadcast. OAD: 10/16/13)  

What starts out as a fun road trip for the “Toy Story” gang takes an unexpected turn for the worse when the trip detours to a roadside motel. After one of the toys goes missing, the others find themselves caught up in a mysterious sequence of events that must be solved before they all suffer the same fate in this “Toy Story OF TERROR!”

The cast of “Toy Story OF TERROR!” includes Tom Hanks as Woody, Tim Allen as Buzz, Joan Cusack as Jessie, Carl Weathers as Combat Carl/Combat Carl Jr., Timothy Dalton as Mr. Pricklepants, Don Rickles as Mr. Potato Head, Wallace Shawn as Rex and Kristen Schaal as Trixie. 

“Toy Story OF TERROR!” is produced by Galyn Susman and directed by Angus MacLane. The special is from DisneyPixar. This program carries a TV-G parental guideline.

Photography and video available at www.abcmedianet.com. Photography request line (818) 460-6611.

Jeff Fordis (818) 460-6676 jeffrey.a.fordis@abc.com

No comments:

Post a Comment