Tuesday, July 15, 2014

Little Darling by The Secret City

Little Darling The Secret City animatedfilmreviews.filminspector.com



This is a whimsical music video for a Sydney, Australia band called The Secret City. Don't know anything about the band, but the animation is fun and matches the music pretty well. An enjoyable little animation that obviously took a lot of work to put together.

Big Cookie Studios is a CG animation studio in Sydney, Australia. Oliver Morton-Evans, who worked with The Wiggles, heads the studio.

Australia, of course, has top-flight animators. Among other things, it was the location of some of Disney's animation operations. So, that we get this fabulous animation from Sydney is really no big surprise.

Little Darling The Secret City animatedfilmreviews.filminspector.com


From the youtube page:

The music video for Sydney band The Secret City's new single Little Darling.

Produced by Big Cookie Studios. (Credits Below)

Set inside an automaton clock, Little Darling tells an enduring love story between two characters who are confined within the clock's mechanism. When the boy stumbles upon a
method to free himself, he must go on a dangerous adventure to save the one he loves...

Little Darling The Secret City animatedfilmreviews.filminspector.com

© 2014 -- The Secret City and Big Cookie Studios

The Secret City is
Rusty Lynch
Brendan Morello
Morgan Murphy

A BIG COOKIE STUDIOS Production

Executive Producer
Oliver Morton-Evans

Writer, Director & DOP
Damian Smith

Co-Writers
Maarten Beldman
Frank Gauntlett

CG Supervisor
Anshul Dayal

Editors
Anil Griffin
David Roberts

Storyboard / Concept Design / Lead Modelling
Laurent Ayoubi
Phil Hassan

Modelling
Kieran Burns
Ketan Chauhan
Gemma Cuneo
Josh Hulands
Christie Lee

Lead Technical Director
Billy Dao

Character Rigger
Jordan McInnes

Lead Texture Artist
Gemma Cuneo

Texturing
Pearl Lai
Christie Lee

Lead Animators
Benjamin Pettit
Paul Ziola

Interim Lead Animator
Rosaline Babayan

Animation
Laurent Ayoubi
Billy Dao
Brendan Thorncraft

Lighting, Render & Compositing
Ketan Chauhan
Billy Dao
Josh Hulands
Pearl Lai
Christie Lee

Interns
Sam Getz
Misha Pitt
Tim Strain

Title & Credit Design
George Barillaro

Colour Grading
Jacqui Creasy
at Pixelated Headspace

Opening Sequence Sound Design
The Secret City and Michael Carpenter
Recorded and Mixed at Love Hz Studios

All Music written by Lynch Morello
Little Darling produced by The Secret City and Michael Carpenter
Recorded at Love Hz Studios
Mixed by Scott Horscroft

With special thanks to
Troy Darben
Kenneth Hui
David Luzinsky
Nelson Matoma
Minh Tran
Yifei Zhao

2014

No comments:

Post a Comment