Wednesday, July 2, 2014

James Rodríguez and his Wonder Goal

Colombia Uruguay animatedfilmreviews.filminspector.com


This is an animation of James Rodríguez’s goal for Colombia against Uruguay.

If you are a big football fan, you need no explanation about how wonderful this goal was, with Rodriguez balancing the ball upon his own chest before teeing it up for the epic shot.

This goal was so good that it has been called a "wonder goal."

Richard Swarbrick animated this short sequence using a rotoscope process. This is a good illustration that enjoyable animation does not have to be complex or intricate, it simply has to be of something that people want to see.


Epic goaaaaaaaaaaaallllllllllll!!!!!!!!!!! Sheer brilliance indeed.







2014

No comments:

Post a Comment

Share
Additional Info