Monday, June 16, 2014

Classic Animated Cel Auction Coming In July

Star Trek Animated Series animatedfilmreviews.filminspector.com
A cel like this from the opening sequence of "Star Trek" - the animated series - is up for sale



If you grew up with Saturday morning cartoons during the 60's and 70's, you may be interested in this.

An auction house in New York City, Heritage Auctions, is putting up for auction original animation cels from some of the classic animation of that time period. Their promotional video is above.

Among the cels being offered are ones from: "Star Trek: the Animated Series"; "Challenge of the Superfriends"; "Hong Kong Phooey" and "Scooby-Doo Where Are You?" and many others.

There's even an original cel from "Yellow Submarine," the classic 1967 animation of The Beatles. It is from a sequence of the lads singing "Nowhere Man."

Since these are original animation cels, they may be just a tiny bit beat up by the passage of decades. These things are not eternal, colors fade and chip, cellulose cracks. But the pictures supplied appear to show them to be in fairly good condition. These are collector's items, of course. Prices should start in the hundreds and for some of the better ones go quickly into the thousands of dollars.

Some of these are going to go for big money. The auction is slated to run July 1-2, 2014 in New York City.

Scooby Doo Where Are You? animatedfilmreviews.filminspector.com
Scooby Doo Where Are You?


2014

No comments:

Post a Comment

Share
Additional Info